(data stored in ACNUC9435 zone)

EMBL: AM180355.CUTC

AM180355.CUTC        Location/Qualifiers
FT   CDS_pept        187366..188040
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="CD630_01410"
FT                   /old_locus_tag="CD0141"
FT                   /product="Copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66961"
FT                   /db_xref="GOA:Q18CN2"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CN2"
FT                   /protein_id="CAJ66961.1"
FT                   /translation="MLEIIGMSVEDAKIIEDCGADRIELVSALTEGGLTPSFGLIESVV
FT                   NSVKIPVNVMIRHHAKSFVYSKEDISIMQKDISVVKEIGANGVVFGVLDKNNNIDEKNL
FT                   NVLLKCCDNLDVTFHRAIDESNTIDSVKILKDYDKITNILTSGGKGSIVHNIQMIKNMM
FT                   LSSNHIKILLGGGLNFNNIEKIKELTKASNFHFGTAIRINNSPFEDIDRQKLKQLVNII
FT                   SR"
     atgttagaaa taataggaat gtcagtagaa gacgctaaaa ttatagaaga ttgtggtgca        60
     gatagaatag agttagttag tgctttaact gaaggtggat tgacaccaag ttttggtctt       120
     atagaaagtg ttgttaacag tgtaaagata cctgtgaacg taatgataag acatcatgcg       180
     aaaagttttg tatacagtaa agaagatata agtataatgc aaaaagatat aagtgtggtt       240
     aaagagattg gtgctaatgg agttgtattt ggtgtattgg ataaaaacaa caatatagat       300
     gagaaaaatc taaatgtttt attgaaatgt tgtgataatc ttgatgttac atttcataga       360
     gccatagatg aatcaaatac aatagatagt gttaaaattt tgaaggatta tgataaaatt       420
     acgaatatat taacatcagg tgggaaagga agtatagttc ataacataca aatgataaaa       480
     aatatgatgc ttagttctaa tcacataaaa attcttttag gtggaggtct taattttaat       540
     aatatagaaa agataaagga attaactaag gcaagtaatt ttcattttgg tacagcgatt       600
     agaataaata acagtccttt tgaagatata gatagacaaa agcttaaaca actcgtaaat       660
     ataatttcaa gatag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page