(data stored in ACNUC9435 zone)

EMBL: AM180355.DNAN

AM180355.DNAN        Location/Qualifiers
FT   CDS_pept        1562..2668
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CD630_00020"
FT                   /old_locus_tag="CD0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66816"
FT                   /db_xref="GOA:Q18C88"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q18C88"
FT                   /protein_id="CAJ66816.2"
FT                   /translation="MKIICNQKILANRIGIAQKAINGKTTIELLKGILISTEEGQLKLT
FT                   GYDAEIGIETYVQAEIIEKGDVVVDARLFGDIIRKLPDSFVEIETDSENNIYINCVNSR
FT                   FKIKGYAAKEFPKLPELNEEDLYSIPQEILKNMIKQTVFAISQDQTKPVLMGELLEIVD
FT                   RNLNLVAIDGYRLAVKSCSVDSLTENIKVIIPGKTLIDVNSLLSGEDNVKVGFNEKNAI
FT                   FIINDTKIITRLLEGDFIDYKKLLPREHNSRVKLNTKELLNSIERASLLSQSEKNNLIK
FT                   LSIRDKVMAITSNTEKGNVYEEVEIDLDGDYLDIAFNSRYFIEGLKNIDNEEIFIEFTT
FT                   NVNPCIIKPTDDVNYIYLLLPVRISSNI"
     ttgaaaataa tttgtaatca aaaaatccta gcaaatagaa ttggaattgc tcaaaaagct        60
     attaatggaa aaacaacaat agaattatta aaaggtatac ttatatctac agaagaaggt       120
     caattaaaac ttactggata tgatgctgaa ataggaatag aaacttatgt acaagcagaa       180
     atcatagaaa aaggtgatgt tgttgtagat gcaaggctat ttggagatat aattagaaaa       240
     ttaccagatt cctttgttga gatagaaact gattcagaaa ataatattta cataaattgt       300
     gtaaattcaa gatttaaaat taaaggttat gcagcaaaag aatttcctaa attaccagaa       360
     ttaaatgaag aagatttata tagcatacct caagaaatcc taaaaaatat gattaaacaa       420
     actgtatttg ctatctcaca ggaccaaaca aaacctgttt taatgggaga acttttagaa       480
     attgtagata gaaacttaaa tttagtagca attgatggat atagattagc tgtaaaaagt       540
     tgttcggttg atagtttaac tgaaaatata aaagtcataa ttcctggaaa gacacttata       600
     gatgtaaata gtttgctttc tggagaggat aatgttaaag ttggatttaa tgaaaaaaat       660
     gctattttta taattaatga tacgaaaatt attacaagat tgcttgaagg agattttatt       720
     gattataaaa aattattgcc aagagaacat aacagcagag ttaaattaaa tactaaggaa       780
     cttttaaata gtatagagag agcgtcttta ttgtctcaat cagaaaaaaa taatcttata       840
     aagttatcta taagagataa agtaatggca attacttcta atacagaaaa aggaaatgtg       900
     tatgaagaag ttgaaataga tttagatgga gattacctag atatagcttt caattctaga       960
     tattttatcg aaggtttgaa aaatatagat aatgaggaaa tatttataga atttactaca      1020
     aatgtaaatc cttgtataat taaaccaaca gatgatgtta attatattta cttactgctt      1080
     ccagtaagaa tatcatcaaa tatatag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page