(data stored in ACNUC9435 zone)

EMBL: AM180355.FLGG

AM180355.FLGG        Location/Qualifiers
FT   CDS_pept        329825..330586
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="CD630_02690"
FT                   /old_locus_tag="CD0269"
FT                   /product="Flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67091"
FT                   /db_xref="GOA:Q18D04"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D04"
FT                   /protein_id="CAJ67091.1"
FT                   /translation="MYTMFYTSKTALSANQSKLDIISNNIANSDSTGYKKINMEYSDLV
FT                   DEVLNRPSYPTNGNDISTGTGAKATAPMRNYEQGALAPTDSKSNLAIDGEGFFRVIRKD
FT                   GTYAYTRNGGFNVDALGKIVDDNGNILDVQFDAGYNYNNTNIDSTNLTVSRNGELFVDN
FT                   KKIGKINLYQPIGTQNFISEGDSLFVATDAAQIKQVEKVDIVQGYRERSNVSLQEEFVD
FT                   LIATQRAFQMNSKGIKTADEMWQIANNLRAK"
     atgtacacaa tgttttatac tagtaaaaca gctttatcag caaatcaaag taaactagat        60
     ataatatcta acaatatagc aaattctgat tcaacaggat ataaaaaaat aaatatggaa       120
     tattctgatt tagtggatga agtactaaat agaccatcat atcctacaaa tggcaatgat       180
     atatcgactg gaacaggagc taaggcaaca gctcccatga gaaattatga acaaggtgca       240
     ttggctccta cagatagtaa gagtaatttg gcaatagatg gagaaggatt ctttagagtg       300
     ataagaaaag atggtacata tgcatataca agaaatggtg gatttaatgt agatgcttta       360
     ggtaagattg tagatgataa tggaaatata ttagatgtcc aatttgatgc aggatataac       420
     tataataata caaatataga tagtacaaac ctgacagttt caagaaatgg agagctattc       480
     gtagataata aaaaaatagg aaaaatcaac ttatatcaac ctataggaac tcaaaatttt       540
     atatctgaag gagatagttt attcgtcgca actgatgcag cacagattaa acaagttgag       600
     aaagtcgata tagttcaagg ctatagagag aggtcaaatg tttctttaca agaagaattt       660
     gttgacttaa tagccactca aagagcattt caaatgaact caaagggaat aaagacagca       720
     gatgaaatgt ggcaaatagc gaataattta agagctaaat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page