(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIE

AM180355.FLIE        Location/Qualifiers
FT   CDS_pept        310011..310328
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="CD630_02470"
FT                   /old_locus_tag="CD0247"
FT                   /product="Flagellar hook-basal body complex protein FliE"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67068"
FT                   /db_xref="GOA:Q18CY5"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY5"
FT                   /protein_id="CAJ67068.1"
FT                   /translation="MPITQINNLIQGAKLDNLIGEAKPLTLNNKEEKKNFEDVIIDTID
FT                   KVNFQQVTADDMKEKFIKGEDVSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNKVQ
FT                   I"
     atgccaatta cacaaattaa caatttaata caaggtgcaa agttagataa tttgattgga        60
     gaagcaaagc cattaactct taataataaa gaagaaaaaa agaattttga agatgtaata       120
     atagatacta tagataaagt taattttcaa caagtaacag cagatgatat gaaagaaaaa       180
     tttataaaag gcgaagatgt ttctatgcat gaagttatgt taataggtca agaagcacaa       240
     ctatctatgc aatatttaat agaagttaga aataagattc atgatgcata tcaagaaatg       300
     aataaggtgc aaatttag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page