(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIF

AM180355.FLIF        Location/Qualifiers
FT   CDS_pept        310353..311903
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="CD630_02480"
FT                   /old_locus_tag="CD0248"
FT                   /product="Flagellar M-ring protein FliF"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67069"
FT                   /db_xref="GOA:Q18CY4"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY4"
FT                   /protein_id="CAJ67069.1"
FT                   /translation="MITSFKNKIKEQVAKSRTKISSLKKGTKIALGIGVIAICLALVFT
FT                   AISASKNKYAVLFSELDAQDAADISAELESKKIDTKVKGSTIYVPRTEVDKLRLELAPS
FT                   LTGGSKGFALMDDSSSIGLTDEEFQIKKQRMIQGEIEKTIKSFPQVEDTRVHITFGESS
FT                   VFEKEAVPGSAAVYLMLKPGTTLEKNQIKSVMALISGSVTNIPEKNVQVIDNKMNLLSE
FT                   GILEDENVDENNQPINSGISVDKNKASEQALNKQLEKSILEMLEPIFGKGKVKATVNAD
FT                   LSFDTAEKTEIKIDPDKVAIKETRSKNSSKSAANNVQGVDANMNNQGNNNGTNTEDSLD
FT                   ESFEYETGKIETHTIVAPGELNRLTASVAIDGKIAKGVQADVEDIVNNAIGMDGARGDT
FT                   LSVVSMVFDPEGKKEAKQELEEIKKEGFKKNIIKAVIGVVAVIAVGAIGYLIYKKRSER
FT                   EDMDYEDEDYISKSDSVDRKDNPLLGDDPELTLEEAVKMYAEEKPDQVTEIIKTWLNE"
     atgataacca gttttaaaaa taagattaag gagcaagttg ctaaatctag gacaaagata        60
     agttctttaa aaaagggaac taaaatagca ttaggtatag gggttattgc tatatgttta       120
     gcgctagtat ttacagcaat atctgcgagc aaaaataagt atgcagtctt attttcagaa       180
     ctagatgctc aagatgctgc agatatatca gcagagctag agtctaaaaa gatagatact       240
     aaggtaaaag gaagtacgat ttatgtacct agaacagaag ttgataagtt aaggctggag       300
     ttagcgccaa gtcttacagg tggttctaaa ggatttgcac taatggatga tagttcatca       360
     atagggctta ctgatgaaga atttcagatt aagaaacaaa gaatgataca aggtgaaata       420
     gaaaaaacaa taaagagttt tccacaagtg gaagacacta gagtacatat aacatttgga       480
     gagtcatcag tatttgagaa ggaggctgtt ccagggagtg cagcagttta tttgatgcta       540
     aaaccaggga cgactttaga aaaaaaccaa ataaagtctg ttatggcact tatatcagga       600
     agcgttacaa atataccaga gaaaaatgtt caggttattg ataacaaaat gaatttatta       660
     tctgaaggta ttttggagga tgaaaatgtt gatgaaaata atcaaccaat aaatagtggc       720
     attagtgttg ataaaaataa ggcatctgaa caagcattga ataaacaact agaaaagtct       780
     attttagaaa tgctagaacc gatatttggt aagggaaagg tgaaagctac agtaaatgct       840
     gatttaagtt ttgatacagc tgaaaaaact gagataaaaa ttgaccctga taaagttgca       900
     ataaaggaga caaggtcgaa aaattcatct aaatctgctg caaataatgt tcaaggtgta       960
     gatgctaaca tgaataacca aggaaataac aatggtacta atacagaaga tagtttagat      1020
     gagagttttg agtatgaaac aggtaagatt gaaactcaca ctatagttgc gcctggagaa      1080
     cttaatagat tgacagcttc tgttgcaata gatggaaaaa tagctaaagg tgttcaagct      1140
     gatgtagagg atattgttaa taatgctata ggtatggatg gagcgagggg agatactctt      1200
     agcgttgttt caatggtatt tgacccagaa ggtaagaaag aggctaaaca agagctggaa      1260
     gagattaaaa aagaaggatt taaaaagaac ataataaaag cagttattgg agtagtagca      1320
     gtaatagcag ttggagctat tggatactta atatataaga aaagaagtga acgagaagat      1380
     atggattatg aagatgaaga ttatatttct aaatctgatt ctgttgatag gaaagataat      1440
     cctctattag gagatgaccc agaactgaca ttagaggaag ctgttaaaat gtatgcagaa      1500
     gaaaagccag accaagtgac agagataata aaaacttggt taaatgagta a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page