(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIH

AM180355.FLIH        Location/Qualifiers
FT   CDS_pept        312979..313710
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="CD630_02500"
FT                   /old_locus_tag="CD0250"
FT                   /product="Flagellar assembly protein FliH"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   . Experimentally verified through Mass Spectrometry as part
FT                   of Spo0A regulated proteome: down-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67071"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY9"
FT                   /protein_id="CAJ67071.1"
FT                   /translation="MNNKIIKSKKASYKGVLDLSIIDKVRVGESNLNKENDCRFRDEVI
FT                   KEAIESAEIKKNEILEEAKINAQNIEKQAYEKGYSQGQKNGYEDGYKESYDEYTQKAKD
FT                   EADFIKNQANLILLQANEKMTEYIKEKNKEIVRLAINMASSVLKKHFEDEESMSDLLKQ
FT                   IIQDYEGSSSFIVRCSSFYKDNIEKEFKLFKEETSLKSSVFVIADDSIDKGNAIIQKEN
FT                   GRIIVGIDCAMEKLKEELLGE"
     ttgaataata agattattaa aagtaaaaaa gcatcatata aaggagtttt agatttatcc        60
     ataatagata aagttagagt gggagaatca aatctaaata aagaaaatga ttgtagattt       120
     agggatgagg taataaagga agctatagaa tctgcagaga taaaaaagaa tgagatatta       180
     gaagaagcaa aaataaatgc acaaaatata gaaaagcaag catatgaaaa agggtatagt       240
     caaggtcaaa aaaatggata tgaggatgga tataaagagt catatgatga atatacccaa       300
     aaagctaaag atgaagcaga ttttataaaa aatcaggcaa atttaatctt attacaagct       360
     aatgagaaga tgactgagta cataaaagaa aaaaataaag agattgtaag acttgctatt       420
     aatatggcca gttctgtttt aaaaaagcat ttcgaagatg aagaatctat gagtgatttg       480
     ttaaagcaaa ttattcaaga ttatgaagga agtagttcat ttatagtaag atgtagttct       540
     ttctataaag ataatataga gaaagaattt aaattattta aagaggaaac atcactaaaa       600
     tcaagtgtat ttgttattgc agatgatagt atagataaag gaaatgctat tatccaaaag       660
     gaaaatggaa gaataatagt tggtattgat tgtgctatgg aaaaactaaa agaagaattg       720
     cttggtgaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page