(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIJ

AM180355.FLIJ        Location/Qualifiers
FT   CDS_pept        315070..315510
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="CD630_02520"
FT                   /old_locus_tag="CD0252"
FT                   /product="Flagellar protein FliJ"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67073"
FT                   /db_xref="GOA:Q18CZ7"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CZ7"
FT                   /protein_id="CAJ67073.2"
FT                   /translation="MDKNFKFRLQKVLDLKVKDEEEIKMEFAKIQQKKIDIETNLENLE
FT                   SNYSKYSISKNNDSIQNQKITINYLLALNNSIMDLSEELDKSTNELEKARKQLISKQIE
FT                   RKSLEKLKEKKYGQYYKEENLKEQNTNDEFASMSYLRNRQVL"
     ttggataaaa actttaagtt tagattacag aaagttttag acttaaaagt gaaagatgaa        60
     gaagagataa aaatggaatt tgctaagatt caacaaaaaa aaatagatat agagactaat       120
     ttagaaaact tagaaagtaa ttatagcaaa tattctataa gtaaaaataa cgatagtatt       180
     caaaatcaaa aaataactat taactattta ctagctttaa acaattctat aatggattta       240
     tcagaagagt tggataagtc aacaaatgaa cttgaaaaag ctagaaagca gcttataagc       300
     aaacagatag agagaaaatc attagaaaaa ttaaaagaaa aaaagtatgg acagtattat       360
     aaagaagaaa atttaaaaga acaaaacact aatgatgagt ttgcaagtat gagttattta       420
     aggaatagac aagttctata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page