(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIN

AM180355.FLIN        Location/Qualifiers
FT   CDS_pept        294131..294445
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CD630_02280"
FT                   /old_locus_tag="CD0228"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67049"
FT                   /db_xref="GOA:Q18CW8"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CW8"
FT                   /protein_id="CAJ67049.1"
FT                   /translation="MNSKKEDIYELNFGQLIEEKTGIIEENQNVFNAKVNVAVSIGNIT
FT                   ETIKNILDLKEGSIIKLNKNVDEKLDIYANDRLFAYGESIITNETLSVRLSKIEDSDVN
FT                   "
     atgaatagca aaaaagaaga tatatatgaa ttgaattttg gtcaattaat agaagaaaag        60
     actgggatta tagaggaaaa tcaaaatgtt tttaatgcta aagtaaatgt ggctgtttct       120
     ataggaaaca taacagaaac aataaaaaat atattagatt taaaagaagg ttctataata       180
     aaactaaata agaatgtaga tgaaaaatta gacatatatg caaatgacag attgtttgct       240
     tatggagaaa gtattattac aaatgaaaca ttatctgtaa gattatctaa aatagaagat       300
     tcagacgtaa attaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page