(data stored in ACNUC9435 zone)

EMBL: AM180355.HADB

AM180355.HADB        Location/Qualifiers
FT   CDS_pept        469086..470312
FT                   /transl_table=11
FT                   /gene="hadB"
FT                   /locus_tag="CD630_03970"
FT                   /old_locus_tag="CD0397"
FT                   /product="Subunit of oxygen-sensitive
FT                   2-hydroxyisocaproyl-CoA dehydratase B"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67218"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q188I1"
FT                   /protein_id="CAJ67218.2"
FT                   /translation="MSEKKEARVVINDLLAEQYANAFKAKEEGRPVGWSTSVFPQELAE
FT                   VFDLNVLYPENQAAGVAAKKGSLELCEIAESKGYSIDLCAYARTNFGLLENGGCEALDM
FT                   PAPDFLLCCNNICNQVIKWYENISRELDIPLIMIDTTFNNEDEVTQSRIDYIKAQFEEA
FT                   IKQLEIISGKKFDPKKFEEVMKISAENGRLWKYSMSLPADSSPSPMNGFDLFTYMAVIV
FT                   CARGKKETTEAFKLLIEELEDNMKTGKSSFRGEEKYRIMMEGIPCWPYIGYKMKTLAKF
FT                   GVNMTGSVYPHAWALQYEVNDLDGMAVAYSTMFNNVNLDRMTKYRVDSLVEGKCDGAFY
FT                   HMNRSCKLMSLIQYEMQRRAAEETGLPYAGFDGDQADPRAFTNAQFETRIQGLVEVMEE
FT                   RKKLNRGEI"
     atgtctgaaa aaaaagaagc tagagtagta attaatgatt tattagctga acaatatgca        60
     aatgcattta aagctaaaga agaaggaaga cctgtaggtt ggtcaacatc agtatttcct       120
     caagagttag cagaagtatt tgacttaaac gtattatatc cagaaaacca agcagctgga       180
     gtagcagcta aaaaaggttc tttagaatta tgtgaaatag ctgaatctaa aggatattct       240
     attgacctat gtgcatatgc aagaacaaat tttggtcttt tagagaatgg tggatgtgaa       300
     gctttggata tgccagctcc agatttccta ctttgctgta acaatatatg taaccaagtt       360
     ataaaatggt atgaaaatat ttcaagagaa ttagatatac ctttaataat gattgataca       420
     actttcaata atgaagacga agttactcaa tcaagaatag attatattaa agctcaattt       480
     gaagaagcta taaaacaact agaaattata tcaggaaaga aatttgaccc taagaagttt       540
     gaagaagtaa tgaaaatatc agctgaaaac ggaagactat ggaagtattc tatgagttta       600
     ccagcagatt cttctccttc tccaatgaat ggatttgact tatttactta catggctgta       660
     atagtttgtg ctagaggtaa aaaagaaact acagaagcat ttaagttact tatagaagaa       720
     ttagaggaca acatgaaaac tggtaaatct tctttcagag gggaagaaaa atacagaata       780
     atgatggaag gtataccttg ttggccatat ataggataca agatgaaaac attagctaaa       840
     tttggagtta acatgacagg tagtgtttat ccacatgctt gggcattaca atatgaagtt       900
     aatgatttag atggaatggc agtagcatat agtactatgt ttaacaatgt aaacctagac       960
     cgtatgacaa aatatagagt tgattcttta gtagagggta aatgtgatgg agcattctat      1020
     catatgaaca gaagctgtaa acttatgagt ttaatacaat atgaaatgca aagaagagca      1080
     gctgaagaaa ctggattacc atatgctgga tttgatggtg accaagcaga ccctagagct      1140
     ttcactaatg ctcaatttga aacaagaatt caaggtttag ttgaagtaat ggaagaaaga      1200
     aaaaaactta atagaggtga gatataa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page