(data stored in ACNUC9435 zone)

EMBL: AM180355.PE118

AM180355.PE118       Location/Qualifiers
FT   CDS_pept        154769..155950
FT                   /transl_table=11
FT                   /locus_tag="CD630_01110"
FT                   /old_locus_tag="CD0111"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66930"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CJ9"
FT                   /protein_id="CAJ66930.1"
FT                   /translation="MINRLKNNTKIKIISFLSAIALWMYVMAVVDPEETKGFEDIPVSI
FT                   SNMSDLKDKNLVIYPDEKLTADVYIKGSLSKVQSVKKEDIHVYGTIEDPIQGQKEVYLK
FT                   ANIPQGVTLEFKHDVLVVNLEKNIKEKRDIKVEVSGNSKRNINKIELSKEFVDVSGPRT
FT                   LVKEVKSVRANLDVGNETDDFSKKLQLIPLNSDGTKVEGVTLSSSFVTAKIELLKEKIV
FT                   PIRVSLNDNKDNDVLKNYKLSKEQVTIKGKKEDIDKISYIKTKPIDLADLANGEEKEVS
FT                   LEIPEGITLEDSSITIKLNDTKQLSAEFLYNAGDIELRNIPTNMDNPNVISDVDIKVVV
FT                   ESTEDLSKLNKKDISLYIDLSQGPEEDSKYKIKYETTYQFKKINIEPNIVEVE"
     atgataaata gactaaaaaa taataccaaa ataaaaataa tatcattttt aagtgcaatt        60
     gcattatgga tgtatgttat ggctgtagtt gaccctgaag aaactaaagg gtttgaagat       120
     atacctgtat ctataagtaa tatgagtgat ttaaaggata aaaatcttgt tatatatcca       180
     gacgaaaaat taacagcaga tgtatatata aaaggtagtt tatcaaaggt acaaagtgtt       240
     aaaaaagaag atatacatgt atatggaacc attgaagacc caatacaagg acagaaggaa       300
     gtatatttaa aagcaaatat tcctcaaggt gttactctag aatttaagca tgatgtttta       360
     gtagtaaatc ttgaaaaaaa cataaaagaa aaaagagata taaaggtaga agtaagtgga       420
     aattcaaaaa gaaatataaa taaaattgaa cttagtaagg aatttgtcga tgtatcaggt       480
     ccaagaactc tagttaaaga agtcaaaagt gtaagagcta atctagatgt tggtaatgag       540
     acagatgatt tttctaaaaa attgcaatta ataccattaa atagtgatgg aactaaggtt       600
     gaaggagtaa cattaagttc atcctttgtg actgcaaaga tagagctatt gaaggaaaaa       660
     attgtcccaa taagagtaag tctaaatgat aataaagata atgatgtact gaaaaactat       720
     aaattaagta aggaacaagt tacaataaaa ggaaagaaag aagatataga caaaataagt       780
     tatattaaga caaaacctat tgacttagct gatttggcta atggtgaaga aaaagaagtt       840
     agcttagaaa ttccagaggg tataactctt gaggatagct ctataacaat taaattaaat       900
     gatacaaaac aattgagtgc agaattttta tataatgcgg gagatattga attaagaaat       960
     atcccaacaa atatggataa tccaaatgta atttctgatg tagatataaa agttgttgta      1020
     gagtcaacgg aggatttgag taagttaaat aaaaaagata tttcattata tattgattta      1080
     tcacaaggcc ctgaggaaga tagtaaatat aaaataaaat atgaaacaac atatcaattt      1140
     aaaaaaataa atatagaacc taatattgtt gaagtggaat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page