(data stored in ACNUC9435 zone)

EMBL: AM180355.PE123

AM180355.PE123       Location/Qualifiers
FT   CDS_pept        158967..159182
FT                   /transl_table=11
FT                   /locus_tag="CD630_01150"
FT                   /old_locus_tag="CD0115"
FT                   /product="putative 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein, delta subunit"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66935"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CK1"
FT                   /protein_id="CAJ66935.1"
FT                   /translation="MAKGKVSFNQERCKGCGLCVEACPVKIIQLDSNVINKKGYNPATV
FT                   FEMEKCIGCASCATMCPDVVITVERD"
     atggctaaag gaaaagtatc ttttaatcaa gaacgttgta aaggttgtgg attgtgtgtt        60
     gaagcatgtc cagtaaaaat catacaatta gactcaaatg taataaacaa aaaagggtat       120
     aacccagcaa ctgtttttga aatggaaaaa tgcataggat gtgcaagttg tgcaactatg       180
     tgtccagatg tagttataac agtagaaaga gattaa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page