(data stored in ACNUC9435 zone)

EMBL: AM180355.PE161

AM180355.PE161       Location/Qualifiers
FT   CDS_pept        202040..204748
FT                   /transl_table=11
FT                   /locus_tag="CD630_01530"
FT                   /old_locus_tag="CD0153"
FT                   /product="putative 4-hydroxyphenylacetate
FT                   decarboxylase,catalytic subunit HpdB"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66973"
FT                   /db_xref="GOA:Q18CP5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CP5"
FT                   /protein_id="CAJ66973.1"
FT                   /translation="MSQSKEDKIRSILEAKNIKSNFQNKENLSEFNEKKASKRAEDLLD
FT                   VYYNTLSTADMEFPYWYNREYRKSDGDIPVVRRAKALKAAFSHMTPNIIPGEKIVMQKT
FT                   RHYRGSFPMPWVSESFFVAQGEQMREEAKKLASNTADELTKFGSGGGNVTESFGNVVSI
FT                   AGKFGMRKEEVPVLVKMAKEWVGKSVEDLGFHYEKMMPDYDLKENLMSTLICMFDSGYT
FT                   LPQGREVINYFYPLNYGLDGIIEMAKECKKAVAGNASGDGLIGMDRLYFYEAVIQVIEG
FT                   LQTWILNYAKHAKYLESIETDLEAKKEYSDLVEILEHIAHKQPRTFREALQLTYTIHIA
FT                   SVNEDAISGMSIGRFGQILYPWYEQDIEKGLITKEEVIELLELYRIKITCIDCFASAGV
FT                   NGGVLSGNTFNTLSIGGLKEDGSTGANELEELLLEASMRCRTPQPSLTMLYDEKLPEDF
FT                   LMKAAECTKLGSGYPAWVNNSNGTTFMMKQFADEGMTVEEARAFALGGCLETSPGCWKQ
FT                   LTLNGKTYSIAGGAGQSAGSGVHFIANPKILELVLMNGKDYRMNIQVFEPHNKPLDTYE
FT                   EVIEVFKDYYKQAINVLERANNIELDIWRKFDTSIINSLLKPDCLDKGQHIGNMGYRYN
FT                   ATLNVETCGTVTMVNSFAALKKLVYDDKAFTIEEMKDAILNNFGFKDALEVGNYSMADQ
FT                   VKVDKTGKYDAIYKACLDAPKYGNNDLYADNILKNYEVWLSKVCEEAQSLYAKKMYPCQ
FT                   ISVSTHGPQGAATLATPDGRLSGTTYSDGSVSAYAGTDKNGVYALFESATIWDQAVVQN
FT                   SQMNLKLHPTTIKGQQGTKKLLDLTRSYLRKGGFHIQYNVVDSETLKDAQKNPDNYRQL
FT                   MVRVAGFTQYWCELGKPIQDEVIARTEYEGV"
     atgagtcaaa gtaaagaaga caaaataaga agtattttgg aagcaaaaaa tattaaatca        60
     aattttcaaa ataaagaaaa tttaagtgaa tttaatgaaa aaaaagcaag taaaagagca       120
     gaagacttat tagatgtata ttataataca ttatctactg ctgatatgga atttccatat       180
     tggtataata gagaatatag aaaatcagat ggtgatatac cagtagttag aagagctaaa       240
     gctcttaaag ctgctttttc acatatgaca ccaaatataa tacctggtga gaaaatagta       300
     atgcaaaaga cacgccatta tagaggttct tttccaatgc catgggtaag tgaaagcttc       360
     tttgttgctc aaggagaaca aatgagagaa gaggcaaaga aattagccag taacacagct       420
     gatgaactta caaaatttgg gtctggtgga ggaaatgtta ctgaaagttt tggaaatgtc       480
     gtttcaatag ctggtaaatt cggaatgaga aaagaagaag tacctgtact tgtaaaaatg       540
     gcaaaggaat gggttggaaa gtctgttgaa gatttaggtt ttcactatga aaaaatgatg       600
     ccagattatg atttaaaaga aaacctaatg agtacactta tatgcatgtt tgattcaggg       660
     tatacacttc ctcaaggtag agaagttata aattattttt atcctttaaa ttatggatta       720
     gatggaatta tagaaatggc aaaagaatgt aaaaaggcag ttgcaggaaa tgcatctgga       780
     gatgggctta ttggtatgga ccgtctatat ttttatgagg ctgttattca agttattgaa       840
     ggattacaaa cttggatttt aaattatgca aaacatgcaa aatacttaga aagtatagag       900
     acagatttag aagctaaaaa agaatactca gatttagtgg agatattaga acatattgca       960
     cataaacaac ctcgtacatt tagggaagct cttcagttga cttatacaat tcatatagca      1020
     tcagtaaatg aggatgctat atctggtatg tctataggac gttttggtca aattttatat      1080
     ccttggtatg aacaagatat agaaaaagga ctaattacaa aagaagaggt tatcgaatta      1140
     ttagagcttt atagaataaa aatcacttgt attgactgtt ttgcttcagc gggcgtaaat      1200
     ggaggagtac tatcaggcaa tacatttaat actttatcta taggtggatt aaaagaagat      1260
     ggttctacag gagctaatga actagaagag ttattattag aagcaagtat gagatgtaga      1320
     actcctcaac ctagtttaac tatgctatat gatgaaaagc ttccagaaga tttcttaatg      1380
     aaagctgctg aatgtacaaa gcttggttct ggttatccag catgggtaaa caactcaaat      1440
     ggaacaacat ttatgatgaa acaatttgct gatgaaggta tgactgttga agaagcaaga      1500
     gcatttgcat taggtggatg tttggaaacg tctccagggt gttggaaaca gttaacttta      1560
     aacggaaaaa cgtactctat tgcaggtgga gcaggtcaat ctgctggctc tggagttcac      1620
     tttatagcta atccaaaaat tttagaactt gttcttatga atggtaaaga ctatcgtatg      1680
     aatatacaag tatttgagcc tcataataag ccattagata cttatgaaga agtcatagaa      1740
     gtatttaaag attattataa acaagcaata aatgttttag aaagagcaaa taacattgag      1800
     ttagatatat ggagaaaatt tgatacttct ataataaatt cactactaaa gccagactgt      1860
     ttagacaaag gtcaacatat aggaaatatg ggatatcgtt ataatgcaac attaaacgta      1920
     gaaacttgtg gtactgttac tatggtcaat tcatttgcag ctcttaagaa acttgtatat      1980
     gatgacaaag catttacaat agaggaaatg aaggatgcca tattaaataa ttttggattt      2040
     aaagatgcat tagaagtagg aaattattct atggcagacc aagtaaaagt agataagact      2100
     ggtaaatatg atgctattta taaggcctgt cttgatgcac ctaaatatgg aaataatgat      2160
     ttgtatgcag ataatattct taaaaactat gaggtatggt tatcaaaagt atgtgaagaa      2220
     gcacaatctt tatatgctaa gaagatgtac ccttgccaaa tatctgtttc tacacatggg      2280
     ccacagggag ctgctacctt ggctactcca gatggtagac taagtggaac aacatattca      2340
     gatggttcag tctctgcata tgcaggaaca gataaaaatg gagtatatgc attatttgaa      2400
     tctgcaacta tttgggacca agcagtagtt caaaattctc agatgaattt aaaacttcat      2460
     ccaactacta taaaaggaca acaaggaact aaaaaattat tagatttaac aagaagttat      2520
     ttaagaaaag gtgggttcca tattcaatat aatgttgtag attcagaaac attaaaagat      2580
     gcacaaaaaa atcctgacaa ttatcgtcaa ttaatggtac gtgttgctgg gtttactcaa      2640
     tattggtgtg aattaggtaa accaatacaa gatgaagtaa ttgctagaac agagtatgaa      2700
     ggggtgtaa                                                              2709
//

If you have problems or comments...

PBIL Back to PBIL home page