(data stored in ACNUC9435 zone)

EMBL: AM180355.PE172

AM180355.PE172       Location/Qualifiers
FT   CDS_pept        216692..216895
FT                   /transl_table=11
FT                   /locus_tag="CD630_01632"
FT                   /old_locus_tag="CD0163B"
FT                   /product="uncharacterised protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: down-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01632"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66984"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CQ3"
FT                   /protein_id="CAJ66984.1"
FT                   /translation="MSFGKRIEMNNIGVETRGVCTIMCPYTCKMMASSSCNCKNNDYNA
FT                   RGGSYNTYYNKLIHGQRTPDGM"
     atgagttttg gaaaaagaat agaaatgaat aatataggtg ttgagacaag aggtgtttgt        60
     actattatgt gtccttatac ttgtaagatg atggcatctt catcttgtaa ctgcaagaat       120
     aatgattata atgcaagagg aggatcatat aatacatatt ataataaatt gatacatggc       180
     caaagaactc ctgatggaat gtaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page