(data stored in ACNUC9435 zone)

EMBL: AM180355.PE19

AM180355.PE19        Location/Qualifiers
FT   CDS_pept        23269..23490
FT                   /transl_table=11
FT                   /locus_tag="CD630_00181"
FT                   /old_locus_tag="CD0018A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62784"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y5X0"
FT                   /protein_id="CCA62784.1"
FT                   /translation="MKPIMNLEEHNAMKEKRVKKMKSKDKPKYDDFEDISFSNKKKTKK
FT                   NVRNKNAEFRNNYKNYQYDYEEDFYEPI"
     atgaaaccaa ttatgaactt agaagaacat aatgcaatga aagaaaaaag agttaaaaaa        60
     atgaaatcaa aagataaacc taaatatgat gattttgagg atataagttt ttctaataag       120
     aaaaaaacta aaaaaaatgt acgaaataaa aatgctgaat ttagaaataa ttataaaaat       180
     tatcagtatg attatgaaga agacttttat gaaccaattt aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page