(data stored in ACNUC9435 zone)

EMBL: AM180355.PE214

AM180355.PE214       Location/Qualifiers
FT   CDS_pept        complement(262205..265633)
FT                   /transl_table=11
FT                   /locus_tag="CD630_02030"
FT                   /old_locus_tag="CD0203"
FT                   /product="putative UvrABC system protein A 1 (UvrA protein
FT                   1) (Excinuclease ABC subunit A 1)"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67024"
FT                   /db_xref="GOA:Q18CU1"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CU1"
FT                   /protein_id="CAJ67024.1"
FT                   /translation="MKINNYKNQSIITNPKKFENKYQDLPKTPIELLKVVQSLVIHGDQ
FT                   GKLYGISFNKQQSDEELLRTIPQMLKRIFEINSNPLTIPRNPKQRLVGMCRDYSLLLVS
FT                   LLRYRGFEARMRAGFANYFESELTYEDHWLVEYYDTLKKRWIRIDAQIDDIQKNYFQIN
FT                   FDTHDVGKTDGFLTGSEAWIRCQQGHAHPDDFGYNKNWKGWHSVKGNLLHDFNNMIGLE
FT                   LLPWDLWTELSSKKYNQLTRAEKNLLDEMAEILSSGNIKIEDLNLLIEKLPEDYLKSIF
FT                   SQLKILGISEIKELGNPLELEKKFKFTKSINKSIKNSLCHNKSSIYLKGGRQNNLKDVE
FT                   VTIPKNQITVITGVSGSGKSSLAFDTIYEEGKRRYFENLSNGAKLSEQLQKPEFDLLQG
FT                   LTPTIAIEQKKGSQNPRSTVGTLTSIWDYLRMLFVSIGKSYCPYCKIPLEKKNNTKNYC
FT                   PHCQTIFSKINTSTFNANSHTGACHDCNGLGFTYQVNPQLIVKDPTISILDGATYYFGK
FT                   LRGKKPNGNWMVGELYAIAKDKNIDLDIPWNELPRDFIDAILYGTDDKIYEFSFESKGR
FT                   ESKIRRPASGAINHIQRLFRESSSENNTLHQYMNKIPCNTCGGELLCIEARFTTIKGYR
FT                   FPELTKMTIEQLWNWLCELPNQLQKNELSLVNDILTELKIRVSYLLKVGLSYISTDRTA
FT                   PTLSGGELQRVRLSSQLGSELVGLTYILDEPSIGLHPRDHNLIIKMIEELRDKGNTVIV
FT                   VEHDKDTILSADYIIDVGPSAGTKGGFIIAEGTTQEIIKNPNSITGKYLSTYNKTGSQN
FT                   KTIPSKWLSLKGCHANNLKNIDVEIPLNCMCSITGVSGSGKSSLVFHSLLPALEEKLKQ
FT                   KSIPDKNYTEFTGFDAIDDFILMDQTPIGKSSRSTPATYINIFDEIRSLFAETPQAKQK
FT                   LLDESYFSFNSKKGQCPNCQGLGKTKIILQYMADQWVTCSECQGKRYQKEILSIQYKGK
FT                   TIADILDMEVAEAKTFFSDCSDIYRKLSLLDEVGLGYLKLGQNTLGLSGGESQRIKLAK
FT                   ELGTKTKKRMLYILDEPTTGLHFKDIENLLITFRKLVNEQHSLLIIEHNTEVIRASDWI
FT                   IDIGPDSGINGGEIVASGTPDEIKINPNSITGHFI"
     atgaaaataa ataactataa aaatcaaagt atcatcacaa atcctaaaaa atttgaaaat        60
     aaatatcaag atttaccaaa gactccaatt gagttattaa aagtggttca aagcctagta       120
     attcatggag accaaggaaa attatatggt atatccttta ataaacaaca atctgatgag       180
     gaattgcttc gtacaattcc tcaaatgtta aaaagaatat ttgaaataaa ttctaaccca       240
     ctaactattc caagaaaccc aaaacaaagg cttgttggaa tgtgcagaga ttattcttta       300
     cttcttgtat cgctcctaag atatcgaggt tttgaggcta gaatgagagc aggttttgct       360
     aattattttg aaagtgagct tacttatgaa gaccactggc ttgtagaata ctatgatact       420
     ctaaaaaaga gatggataag aatagatgca caaatagatg acatacaaaa gaattatttt       480
     caaattaatt ttgacactca tgatgtcgga aaaacagatg gttttttaac tggttcagaa       540
     gcctggataa gatgtcagca aggacatgct catccagatg actttggata taataaaaat       600
     tggaaaggtt ggcattctgt aaagggtaat cttctacatg actttaataa tatgattggt       660
     ttagaattgc ttccatggga tttatggaca gaattaagtt ccaaaaaata caatcaatta       720
     acaagagcag aaaaaaattt attagatgaa atggcagaga tattatcaag cggaaatata       780
     aaaatagaag accttaattt gttaatagaa aaattgcctg aagattattt gaaatcaatc       840
     ttttctcagt taaaaatatt aggtatttcg gaaataaaag aattaggcaa tcctcttgaa       900
     ctagaaaaga aattcaaatt tacaaaatca ataaataaat caattaaaaa ttcactttgt       960
     cataataaaa gctctatcta tttaaaagga ggaaggcaaa acaatttaaa ggatgttgag      1020
     gttacaattc caaaaaatca aataactgtt attacaggtg taagtggtag tggaaaatct      1080
     tctttagctt tcgatacgat ttatgaagaa ggaaaaagac gttattttga aaatctaagt      1140
     aatggagcaa aactttcaga acagcttcaa aaaccggaat ttgatttact tcagggatta      1200
     acccctacta tagctatcga acagaaaaaa ggaagccaaa atcctcgctc tactgttggt      1260
     actcttacaa gcatttggga ttatttaaga atgttatttg tatcaatcgg aaaaagttac      1320
     tgtccatatt gtaaaattcc attagaaaaa aagaataata caaaaaatta ttgtccgcat      1380
     tgtcaaacta ttttttctaa gataaatact tcaaccttca atgctaactc ccatactgga      1440
     gcttgtcacg attgtaatgg attaggtttt acctatcaag ttaatcctca attgattgta      1500
     aaagacccaa ctatttcaat attagatgga gccacttact attttggaaa attgaggggg      1560
     aaaaagccaa atggtaattg gatggtaggt gaattatatg caatagcaaa agataaaaat      1620
     atagacctag atataccttg gaatgaatta ccaagagatt ttatagatgc aatcttatat      1680
     ggtacagacg ataagatata tgaatttagc tttgaatcaa agggacgaga atcaaagatt      1740
     agaagacctg cttcaggagc aatcaaccac attcaaagac tttttagaga atctagttct      1800
     gaaaataata ccttgcatca atatatgaac aaaattcctt gcaatacatg tggtggcgaa      1860
     ttgctgtgca ttgaggctag attcactaca atcaaaggtt atcgcttccc tgaactaaca      1920
     aaaatgacga tagaacagtt atggaattgg ttgtgtgaat taccaaatca acttcaaaaa      1980
     aatgagctct ctttggtaaa tgatatctta acagaattaa aaattcgagt tagttatcta      2040
     ttaaaggtag gtcttagcta tatatcaaca gatagaacag ctccaacttt atctggagga      2100
     gaactgcaga gagtacgatt atcaagtcag ctaggaagtg aattagtagg cttaacctac      2160
     attttagatg aaccatctat tggtttacac ccaagagacc ataatttaat catcaaaatg      2220
     atagaagaac taagagataa gggtaatact gttatagttg tggaacacga taaagataca      2280
     atactgtctg ctgattatat tattgatgta ggcccaagtg ctggtacaaa aggggggttc      2340
     attattgcag aaggtacaac ccaagaaatt ataaaaaatc caaactctat aacaggtaaa      2400
     tatttaagta catacaataa aacaggttca caaaataaaa ctataccaag taaatggtta      2460
     agcttaaaag gatgccatgc aaataactta aaaaatattg atgtagaaat tcccttaaac      2520
     tgtatgtgct ctattacagg tgttagtggt tctggtaaga gctctcttgt atttcacagt      2580
     ttacttcctg ctctagaaga aaaattgaaa caaaaatcta tcccagataa aaattatact      2640
     gaatttactg gatttgatgc tattgatgat tttatcttaa tggaccaaac acctattgga      2700
     aaatctagcc gttctacacc tgctacatat atcaatattt ttgatgaaat tcgttctcta      2760
     tttgctgaaa ctccacaagc aaaacaaaaa ttattggatg aaagctattt tagctttaat      2820
     agcaaaaagg ggcaatgccc aaactgtcaa ggattaggta aaacaaaaat tattctgcaa      2880
     tatatggcag accaatgggt aacttgtagt gaatgtcaag gtaagagata tcaaaaagaa      2940
     atactgtcta tacaatacaa gggaaagaca attgcagata tacttgacat ggaagtagca      3000
     gaagcaaaaa cattttttag cgattgctct gatatatata gaaaactctc cttattagat      3060
     gaagtgggac ttggatatct aaagcttgga caaaatacat taggattaag tggaggagaa      3120
     tctcaaagga taaaattagc aaaagaatta gggacaaaaa ctaaaaaacg aatgctgtac      3180
     atattggatg agcctactac tggacttcat tttaaagata tagaaaattt gttaattact      3240
     tttagaaaac ttgtaaatga acagcattca cttttaatta ttgaacacaa tacagaggtt      3300
     atacgtgctt ctgattggat tatcgatata ggtccagaca gtggaataaa tggaggggaa      3360
     attgttgctt ctggaactcc tgatgaaata aaaataaatc caaatagtat tactggacat      3420
     tttatataa                                                              3429
//

If you have problems or comments...

PBIL Back to PBIL home page