(data stored in ACNUC9435 zone)

EMBL: AM180355.PE279

AM180355.PE279       Location/Qualifiers
FT   CDS_pept        328398..328820
FT                   /transl_table=11
FT                   /locus_tag="CD630_02670"
FT                   /old_locus_tag="CD0267"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67089"
FT                   /db_xref="GOA:Q18D06"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D06"
FT                   /protein_id="CAJ67089.1"
FT                   /translation="MIQIILIVVSILIIVTIVINLHKESKNKDNRYFDKIFEQEYEAND
FT                   RLIIAEKRRFFLDKVLAEKRSNSHIKVYENYNLIKANEERKENIFIESKKEVRQENELS
FT                   LKVKHLISSGYDDVEICKMLDIGKGELLLIRSCYKI"
     atgatacaaa ttatattaat agtagtgtct attttaataa tagtaactat agttataaat        60
     ttacataagg aatcaaaaaa taaagataac agatactttg ataaaatatt tgagcaagaa       120
     tatgaagcaa atgatagatt aataattgca gaaaaaagaa gattcttttt agacaaagta       180
     cttgcagaaa aaagaagtaa tagtcatata aaagtttatg aaaattataa cctaataaag       240
     gctaatgaag aaagaaagga aaacatattt atagaatcaa aaaaggaagt aagacaagaa       300
     aatgagttat ctcttaaagt gaaacatctt ataagttcag gttatgatga tgtggaaata       360
     tgtaagatgc tagatattgg aaagggggaa ctgttattaa taaggagttg ttacaaaata       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page