(data stored in ACNUC9435 zone)

EMBL: AM180355.PE280

AM180355.PE280       Location/Qualifiers
FT   CDS_pept        328805..328990
FT                   /transl_table=11
FT                   /locus_tag="CD630_02671"
FT                   /old_locus_tag="CD0267A"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02671"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62788"
FT                   /db_xref="GOA:F3Y621"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y621"
FT                   /protein_id="CCA62788.1"
FT                   /translation="MLQNIRILLCDKKVFLGIGIGILISTLCIMLFSNNDMSKAEIEKK
FT                   ARALGMKYTSEMKVLE"
     ttgttacaaa atataaggat attattatgt gataaaaaag tattcttagg aataggtatt        60
     ggtatattaa tatcaacttt atgtataatg ctttttagta ataatgatat gagtaaggca       120
     gagatagaaa aaaaggccag agcgttaggc atgaaatata caagtgagat gaaagtttta       180
     gaatag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page