(data stored in ACNUC9435 zone)

EMBL: AM180355.PE287

AM180355.PE287       Location/Qualifiers
FT   CDS_pept        335358..335558
FT                   /transl_table=11
FT                   /locus_tag="CD630_02731"
FT                   /old_locus_tag="CD0273A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02731"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62789"
FT                   /db_xref="GOA:F3Y622"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y622"
FT                   /protein_id="CCA62789.1"
FT                   /translation="MNLNTLKQIYKKYSISVMRKKCLKMNFSVHEALFLCEIKFILIIS
FT                   TMKNIFISILRQTILYFFIFG"
     ttgaatttga atacattgaa gcaaatttat aaaaagtatt caatatcagt gatgagaaag        60
     aagtgtctca aaatgaactt ttcagttcat gaggcgcttt ttttatgtga aattaaattt       120
     attttaatca tttcaacaat gaaaaatata tttatctcta ttttgagaca gaccattctt       180
     tattttttta tctttggtta a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page