(data stored in ACNUC9435 zone)

EMBL: AM180355.PE294

AM180355.PE294       Location/Qualifiers
FT   CDS_pept        341076..341282
FT                   /transl_table=11
FT                   /locus_tag="CD630_02791"
FT                   /old_locus_tag="CD0279A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02791"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67102"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D21"
FT                   /protein_id="CAJ67102.1"
FT                   /translation="MSKYSSLWEYVKKNNSQSFKLTFEEIKDIAGIEIDHSFLKYKKEL
FT                   NEYGYQVGKISLKEKTVIFDKIG"
     atgagtaaat atagttcttt atgggaatat gttaagaaaa acaatagtca atcgtttaaa        60
     ttaacttttg aagaaataaa agatattgct gggatagaga tagaccattc gtttttgaaa       120
     tataaaaagg aattaaatga atatggatat caagtaggaa aaatctcttt aaaagagaag       180
     actgttattt tcgataaaat tggttaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page