(data stored in ACNUC9435 zone)

EMBL: AM180355.PE308

AM180355.PE308       Location/Qualifiers
FT   CDS_pept        354353..355270
FT                   /transl_table=11
FT                   /locus_tag="CD630_02930"
FT                   /old_locus_tag="CD0293"
FT                   /product="ABC-type transport
FT                   system,bacitracin/multidrug-family ATP-binding protein"
FT                   /EC_number="3.6.3.30"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67115"
FT                   /db_xref="GOA:Q18D31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D31"
FT                   /protein_id="CAJ67115.2"
FT                   /translation="MNIVSINGLSKGFGNRKIIDNLNFTVPEGSVFGFVGKNGAGKTTT
FT                   MKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEIT
FT                   GLSKKEIQIRSEELLSLVGLGNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTSA
FT                   LDPVGRKEILDIMLKIKDSTTVIFSTHILSDVERICDHVAILNKGSIALSGTLSEIKSM
FT                   HGKDRLLLEFASNDEIQKFKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAE
FT                   MNLCPVKMELIELSLENLFLEVVK"
     atgaatattg tctcaataaa tggattatca aaaggttttg gtaatcgaaa gataatagat        60
     aatttaaatt ttactgtacc agaagggtca gtctttgggt ttgtaggtaa gaatggtgca       120
     ggtaagacta caacaatgaa aatggtactt gggttacttg aaccagatag tggaactata       180
     gatgtttgtg gtgagaaagt gacctatgga agaacaagtt ctaatcgtca tgtaggttat       240
     ctgcctgatg ttccagagtt ttacaactat atgagaccac ttgaatatct ttctctttgt       300
     ggtgaaatta cgggactttc aaaaaaagaa atacagataa ggagtgaaga gttgttatca       360
     cttgtgggtc ttggaaatga aaagagacga ataggtgggt tttctcgtgg aatgaagcaa       420
     cgacttggta tagcccaagc tttgctttca cgccccaaat tacttatttg tgatgaacca       480
     acaagtgcac ttgaccctgt tggtcgaaaa gaaatattag atattatgct taaaatcaaa       540
     gactcaacaa ctgtaatatt ttcaacacat atactatcag atgttgaaag aatctgtgac       600
     catgttgcta tattaaacaa aggaagcatt gcccttagtg gtacactttc agaaataaaa       660
     agtatgcacg gaaaggatag acttttactg gagtttgcaa gtaatgatga aattcaaaag       720
     tttaagtcta gtgatggtat taaatcctta ctaaaagatt cagaagaaac taatatggaa       780
     attgttttgc atggtaaaga tataaaagca atacaaaaaa cagttatatc tacactcgca       840
     gaaatgaatc tttgtccagt aaagatggaa ctaatagaat tatcacttga aaatttattt       900
     ttggaggtag taaagtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page