(data stored in ACNUC9435 zone)

EMBL: AM180355.PE31

AM180355.PE31        Location/Qualifiers
FT   CDS_pept        49299..51476
FT                   /transl_table=11
FT                   /locus_tag="CD630_00300"
FT                   /old_locus_tag="CD0030"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66844"
FT                   /db_xref="GOA:Q18CB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CB5"
FT                   /protein_id="CAJ66844.1"
FT                   /translation="MRKKIISFLATFIIILTSASQYSFADDISTRGKVIFIDMNRTSMS
FT                   NMLRIKSLREELDNRGYIGLMNIRGDKGSDDRRSYASMGAGGRANVANEEDINFESSNK
FT                   DRNIVFESATGKSAKGINNLTINKSINENLNFGEYGSVLGSLGQSLSDNGLKASVLGNS
FT                   DIIENGQLIKNRNLCLTAMDEYGRIPNGNVDTINKKDLSMPYGISTDYDKLIVETKEAY
FT                   KNNDVIFVELGDTYRLDLYKPNLNEKTYESMKDNIEKNIDIYLKNIFSMVEENDTIYIA
FT                   SAFPSDLDYKNKRRLSPIIKLNGEGKGILSSSTTRREGIVTNLDVGVEILDNFNIKNQN
FT                   MVGRKYELINRDDNKEFLMDEYQKIVSISSIRSTILNGFVSIVFLSWIVAMIAILFRKH
FT                   ISKNYKETTFFILKELLKIGIVMPLSFMITPIMNFKTPLAISLGIIIITLTIYLISKVL
FT                   IKNDLKNMLFFTGLTIVIMVIDAGFGSYLMKSNVMSYDCIIGARYYGVGNEYQGVAIGS
FT                   AIFTFAILLTYKNIPKWSIIVFSLVILITSASPIMGANVGSAISECVAFLLFILLIYNV
FT                   KIDFKKIVLLGIAVVFVLGVFVAIDMILGSNSHLGMFVKEIYFNGPGEIIQTFSRKIEM
FT                   NLKLAQTSAWVNILLTGIGVILVLMINQIRYFKQLMDEYPIVFKGFIASIAGCLVTLLV
FT                   NDSGIVSSATAFIYVIVPMITLSINLTALKE"
     atgagaaaaa agattatatc tttcttagca acatttatca taatattaac atcagcaagt        60
     cagtatagtt ttgcagatga tatatcaaca cgtggaaaag taatatttat agatatgaat       120
     agaactagta tgagtaatat gttaagaata aaatcattaa gagaagaact agacaataga       180
     gggtatattg gcttgatgaa tataagaggc gataaaggaa gtgatgatag aaggtcatat       240
     gctagtatgg gtgctggtgg tagagctaat gtggctaatg aagaagatat taattttgaa       300
     agctcgaata aggatagaaa tatagttttt gaatcagcta caggaaaaag tgcaaaaggt       360
     ataaataatt taactataaa taagtctata aatgaaaatt taaactttgg agagtatggt       420
     tctgtattag ggtcattagg acaaagttta tctgataatg gattaaaagc atctgtattg       480
     ggtaattcag atataattga aaatggtcaa cttataaaaa atagaaactt atgtctaact       540
     gcaatggatg aatatggaag aatacctaat ggaaatgtag atactataaa taaaaaagac       600
     ttatctatgc cttatggaat atcaactgat tatgataaat tgattgtaga gactaaagaa       660
     gcttacaaaa ataatgatgt gatttttgtg gagcttggag acacatatag attagattta       720
     tataaaccaa atttaaatga aaaaacatat gagagtatga aagataacat agaaaaaaat       780
     atagatatat atttaaaaaa tatattttct atggttgaag aaaatgacac tatctacata       840
     gcaagtgcat ttccaagtga tttagattat aaaaataaaa gaagactttc tccaataata       900
     aaattaaatg gagaagggaa aggtatatta tcatcttcaa ctactagaag agaaggtatt       960
     gtaacaaatt tagatgttgg ggttgaaata ttagacaact ttaatataaa aaatcaaaat      1020
     atggttggaa gaaaatatga acttattaac agagatgata ataaagaatt tttgatggat      1080
     gaatatcaaa agatagtatc tatttcaagc ataaggtcta caatactgaa tggttttgta      1140
     agtatagttt tcttgtcatg gatagttgct atgattgcaa ttttatttag aaagcatata      1200
     tcaaaaaatt ataaagaaac aacatttttt atattaaagg aacttttaaa aataggaata      1260
     gtaatgccac tgtcatttat gataacacca ataatgaatt tcaaaacacc attagcaata      1320
     tctttaggaa taattataat aacacttact atatatctta taagtaaagt tttaataaag      1380
     aacgatttaa aaaacatgct gttttttact ggattaacca tagtaattat ggttattgat      1440
     gctgggtttg gctcatattt aatgaaaagc aatgttatga gttatgattg tataattgga      1500
     gctagatatt atggagtagg aaatgagtat caaggtgtgg caatcggtag tgcaatattt      1560
     acatttgcaa ttttacttac atataaaaat ataccaaagt ggtctataat agttttttct      1620
     ttggttatct taattacaag tgcatctcca attatgggag caaatgttgg aagtgctatt      1680
     tctgaatgtg ttgcattttt actatttata ctattgatat ataatgtaaa gatagatttc      1740
     aaaaaaatcg tattattagg tatagcagta gtatttgtat taggagtttt tgtagcaata      1800
     gatatgattt tgggaagtaa ttcacattta ggtatgtttg taaaagaaat ttactttaat      1860
     ggaccaggag aaataataca aacatttagt agaaagatag agatgaattt aaagctagct      1920
     caaaccagtg catgggtaaa tatactgtta actggaatag gtgtaatttt agttcttatg      1980
     attaatcaga ttagatactt taagcaactg atggatgagt atccaattgt atttaaagga      2040
     tttatagcat caatagcagg atgtttagta actcttttag tgaatgactc tgggattgtg      2100
     tcatcagcta cagcctttat ttatgtaatt gtacctatga taacattaag tataaatctt      2160
     acagcattaa aagaataa                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page