(data stored in ACNUC9435 zone)

EMBL: AM180355.PE337

AM180355.PE337       Location/Qualifiers
FT   CDS_pept        complement(387748..387936)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03210"
FT                   /old_locus_tag="CD0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67143"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D59"
FT                   /protein_id="CAJ67143.1"
FT                   /translation="MEYMSCPEVAKKWGISERRVQKLCEESRIPGVSKLGYMWLIPKNA
FT                   EKPVDGRTKRRKEVQYE"
     atggaatata tgtcttgccc agaagtagca aaaaaatggg gtatttctga aagaagagta        60
     caaaaactat gtgaagaaag tcgcatacca ggagtttcaa aactcgggta tatgtggctg       120
     ataccaaaga acgcagaaaa gcctgttgat ggtagaacaa aaagaagaaa ggaagtacaa       180
     tatgaatag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page