(data stored in ACNUC9435 zone)

EMBL: AM180355.PE360

AM180355.PE360       Location/Qualifiers
FT   CDS_pept        420193..421104
FT                   /transl_table=11
FT                   /locus_tag="CD630_03440"
FT                   /old_locus_tag="CD0344"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67166"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D83"
FT                   /protein_id="CAJ67166.1"
FT                   /translation="MNLTKVKGNTFFIKGGTNTGIYVFEDNTALMIDPGLCGSRPRRVN
FT                   KVLDENNIQVRYIINTHGHDDHYGACNQFKEYYKDVCIMSSEYDKLYIENPELFSKYIV
FT                   GGKSNVFMDNILKNKMLDDIKIDKSIEAGKFELNNEMFDIIEFQGHTPGSIAVLTKDNV
FT                   IFVGDLLIGDEILSKYDFLFLYDIQEQINSLEKLKNIDFEYLVLGHGKQVISKEDSYKL
FT                   IEKHLNALKKYLYQIRELLVEPKSLEILLKNIINNNNLSNNYKEYHFFKSSLVSVISYL
FT                   VDLEEIGYILENGELLYYTKTK"
     gtgaatctta caaaagtaaa aggaaatacc ttttttataa aaggtggcac gaatacagga        60
     atatatgtat ttgaagataa cacagcactt atgatagacc cagggttatg tggttcaaga       120
     cctaggagag taaataaagt attagatgaa aataatatac aggttagata tattataaat       180
     actcatggtc atgatgacca ctatggagct tgtaatcaat ttaaagaata ttataaagat       240
     gtgtgtataa tgtcatctga atacgataaa ttatatatag aaaatccaga attgttttca       300
     aagtatattg ttgggggaaa gagcaatgta tttatggata atatcttaaa aaataaaatg       360
     ttggatgata taaaaataga taaatctata gaagctggaa aatttgaatt aaacaatgaa       420
     atgtttgata taattgaatt tcagggtcat acacctggta gtatagctgt tttgacgaag       480
     gataatgtga tttttgttgg cgatttattg ataggagatg aaattttatc aaaatacgat       540
     ttcttgtttc tatatgatat acaagaacaa ataaattcat tagaaaaatt aaaaaatata       600
     gattttgagt acttagtttt agggcatggc aagcaagtta tatcgaaaga agattcttat       660
     aaattaatag aaaaacattt gaatgcttta aaaaaatatt tatatcaaat aagagagttg       720
     cttgtagaac cgaaatcttt agaaatttta ttaaaaaaca ttataaataa caataattta       780
     agcaataatt ataaagagta tcattttttt aaatcttcgt tagtatctgt cataagttac       840
     ttagttgatt tagaagaaat agggtatata ttggaaaatg gagaattgct ttactataca       900
     aaaacaaaat aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page