(data stored in ACNUC9435 zone)

EMBL: AM180355.PE379

AM180355.PE379       Location/Qualifiers
FT   CDS_pept        complement(435772..436542)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03640"
FT                   /old_locus_tag="CD0364"
FT                   /product="ABC-type transport system, ATP-binding protein
FT                   Tn916-like, CTn1-Orf9"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67186"
FT                   /db_xref="GOA:Q18DA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DA1"
FT                   /protein_id="CAJ67186.1"
FT                   /translation="MEHILNLEQVKKYYGGNSGNITKAVDGISMYVDKGEFVAIMGASG
FT                   SGKTTLLNCISTIDTVTSGHITVNNQDITKIKDKDFADFRRENLGFIFQDFNLLDTLTI
FT                   EENISLSLIINKQNSADIEKRVHSIADKLGIRDILLKFPYEVSGGQKQRCACARALINE
FT                   PKLILADEPTGALDSKSSRLLLETMSDINNKMQATILMVTHDPFSASFCERILFLKDGK
FT                   IFNEIFRGEKSRKDFFNEILDILTLLGGEVGNVR"
     atggaacaca ttttgaattt agaacaagta aaaaaatact acgggggtaa ctctggaaat        60
     atcacaaagg cagtagacgg tatttctatg tatgtagata agggcgaatt tgtcgcaatc       120
     atgggagcta gtggctctgg aaagactacc ctattaaact gtatttctac gattgatacc       180
     gtaaccagcg gacacattac agttaataat caagatatta ccaaaatcaa ggataaagat       240
     tttgctgatt tcagacgtga aaatcttggg ttcatttttc aagactttaa ccttttagat       300
     acgttgacga ttgaggaaaa catttctttg tcattgatta tcaacaaaca gaactctgct       360
     gatattgaga aaagggttca ttctatcgct gacaaattag gtattcgaga tattttatta       420
     aaattccctt acgaagtttc gggtggacaa aaacagcgtt gtgcttgtgc gagggcttta       480
     atcaatgaac caaaactgat tttagctgat gaaccaacgg gagctttgga ctcaaaatct       540
     tccagattgt tactggaaac aatgtctgac atcaacaata aaatgcaggc tactatttta       600
     atggtaacac atgacccgtt tagtgcgtct ttctgtgagc gtattctgtt cttaaaagac       660
     ggtaagatat tcaatgaaat tttcagagga gaaaaaagca gaaaagattt cttcaatgaa       720
     atattggata tattaacctt gctcggaggt gaagtgggaa atgttaggta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page