(data stored in ACNUC9435 zone)

EMBL: AM180355.PE392

AM180355.PE392       Location/Qualifiers
FT   CDS_pept        complement(448198..448701)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03770"
FT                   /old_locus_tag="CD0377"
FT                   /product="putative antirestriction protein
FT                   Tn916-like,CTn1-Orf22"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67199"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DB5"
FT                   /protein_id="CAJ67199.1"
FT                   /translation="MQETRVLVETRGTTGEETTSYWFDLPIDVAEFEEKLGVGAESGDY
FT                   RIIEKVLPYADEVHEHTSVYQLNELDYMYHQLSSDMQEEYTALLTVYENLEALYICRNV
FT                   ITVYHDCKSMIDVARQKLMNDPTFKHLSEDCQEYYFDFEAYASHLLENRRYLVTEHSVF
FT                   ELPE"
     atgcaggaaa caagggtgct ggtggaaacg agaggaacaa ctggcgaaga aacaacgtcg        60
     tactggttcg acctgccgat agatgttgct gagtttgaag aaaagctagg tgtcggtgca       120
     gaaagtgggg attaccgcat tatcgaaaag gtgttgcctt atgctgatga agtccacgaa       180
     catacaagtg tgtatcagct caacgaatta gattatatgt accaccagct ttccagcgat       240
     atgcaggaag aatataccgc acttcttact gtatatgaga acttagaggc tctttatatt       300
     tgcaggaacg taattaccgt ttatcacgac tgtaaaagca tgattgatgt tgcaagacaa       360
     aagctgatga acgacccgac gtttaaacat ttatccgagg actgtcaaga atattacttt       420
     gactttgaag cctacgcttc tcatttgctg gaaaatagac gctatcttgt aacagaacac       480
     agcgtctttg aactgccaga gtag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page