(data stored in ACNUC9435 zone)

EMBL: AM180355.PE400

AM180355.PE400       Location/Qualifiers
FT   CDS_pept        complement(453006..453332)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03850"
FT                   /old_locus_tag="CD0385"
FT                   /product="putative conjugative transposon protein DUF961
FT                   family Tn916-like, CTn1-Orf30"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67206"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DB8"
FT                   /protein_id="CAJ67206.1"
FT                   /translation="MELKYVVPNMAQTFGNLEFAGENRTEHQRINGRYSPVSRSFNLYS
FT                   DVQRADDIIVTIPAKAGEKHFKPEQRVQLINPKITADGKNVKGRGFTNYILTADDMLPV
FT                   EESK"
     atggaattaa aatatgtagt accaaacatg gcacagactt ttggaaactt ggaatttgca        60
     ggcgaaaaca gaaccgaaca tcaacgcatt aacggacgct attcgcccgt atcaagaagc       120
     tttaacttgt actctgatgt gcagagagcc gacgacatta tcgtaaccat tccagcaaaa       180
     gcaggagaaa agcattttaa gccagaacag cgagtacagc ttatcaatcc aaagattacc       240
     gctgacggta aaaatgtcaa aggacgaggc ttcacaaatt atatcttaac ggctgatgat       300
     atgttaccag tcgaggaaag caagtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page