(data stored in ACNUC9435 zone)

EMBL: AM180355.PE401

AM180355.PE401       Location/Qualifiers
FT   CDS_pept        complement(453368..453553)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03851"
FT                   /old_locus_tag="CD0385A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67207"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DC4"
FT                   /protein_id="CAJ67207.1"
FT                   /translation="MRKGKSRSPPKLSNGRLPLILACLPTTCKNTDSQGCVSIDFTLYY
FT                   LWDCWYFLNRQNKKQN"
     atgagaaaag gaaaatcacg ctctccgccg aagctgtcaa acggcagact tccgcttatt        60
     ctggcttgtc tgcctacaac ctgcaagaac acggatagtc aagggtgcgt aagcattgat       120
     tttacccttt actatctgtg ggattgctgg tatttcctta accgccagaa taagaaacaa       180
     aactaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page