(data stored in ACNUC9435 zone)

EMBL: AM180355.PE434

AM180355.PE434       Location/Qualifiers
FT   CDS_pept        486717..487106
FT                   /transl_table=11
FT                   /locus_tag="CD630_04170"
FT                   /old_locus_tag="CD0417"
FT                   /product="putative conjugative transposon protein
FT                   Tn1549-like, CTn2-Orf11"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67239"
FT                   /db_xref="GOA:Q188K3"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:Q188K3"
FT                   /protein_id="CAJ67239.1"
FT                   /translation="MAYVPIPKDLNRVKTKVAFNLTKRQLIGFTLAGLVGIPVYLFIRK
FT                   FVPNDIAVIFLIVSTLPIFFITLFEKDGLTFEKYFKHIYLHKFYQPKKRVRKEVYLEQE
FT                   KKNSANKTHAKRKGIEKSKAGLKEK"
     atggcatatg taccaatccc taaagactta aatagggtaa agacaaaggt tgcttttaac        60
     ctaacgaaaa ggcagctcat aggcttcaca cttgcaggac tggttggaat accagtctat       120
     ttatttataa ggaagtttgt gccaaatgac atagctgtca tattccttat cgtgtccacg       180
     cttcctatct ttttcatcac actatttgaa aaggacggac tgacctttga gaaatatttt       240
     aagcacattt accttcataa gttttatcag ccaaaaaaga gagtgagaaa ggaggtttac       300
     cttgaacaag aaaagaaaaa ttcagcaaat aaaactcatg caaaacgaaa aggcattgag       360
     aagtcaaaag cgggacttaa agaaaagtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page