(data stored in ACNUC9435 zone)

EMBL: AM180355.PE447

AM180355.PE447       Location/Qualifiers
FT   CDS_pept        509017..509619
FT                   /transl_table=11
FT                   /locus_tag="CD630_04290"
FT                   /old_locus_tag="CD0429"
FT                   /product="putative membrane protein Tn1549-like,CTn2-Orf24"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67252"
FT                   /db_xref="GOA:Q188L9"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:Q188L9"
FT                   /protein_id="CAJ67252.1"
FT                   /translation="MSEKKLTVRDIVTVAIMIALFFAISIVIGMGTVTMPILYLYGTAG
FT                   IEMFIGAIFYLVAANRVNKHGLLFIWILIYGLITAAMGYVFMLPYFIGLAIICELTMIG
FT                   KNTYRNPIRNMIGWCTYAIGMFLGIGVPCWIAWESYQKQALAGGFADTTLKLQYEMVSS
FT                   PSLILVGVAVTVILSALGILFAQKILKKHFKKAGILD"
     atgtcagaaa aaaaattaac agtaagagat attgtaacag ttgcaattat gatagcatta        60
     ttttttgcta tttcgattgt tattggtatg gggacagtta ctatgccgat tttatatttg       120
     tatggtacgg caggaattga aatgtttata ggagcaatat tttatcttgt tgcagcaaat       180
     agagtcaata agcatggact actatttatt tggattttaa tttatggttt gataacagca       240
     gcgatgggat atgtgtttat gcttccatat tttatcggat tagcaattat atgtgaactt       300
     acaatgattg gaaagaatac ttatagaaat ccaattagaa acatgattgg ctggtgtacc       360
     tatgcaatag gaatgtttct tggtataggg gtaccttgtt ggattgcatg ggaaagctat       420
     caaaaacaag cacttgcagg tggatttgcg gatactacat taaagcttca gtatgaaatg       480
     gtatcttcac catcattgat attagtagga gtagctgtaa cagttatttt atctgcatta       540
     ggaattttat ttgcacaaaa aatattgaaa aaacatttta agaaggcggg tatattagat       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page