(data stored in ACNUC9435 zone)

EMBL: AM180355.PE481

AM180355.PE481       Location/Qualifiers
FT   CDS_pept        544648..545364
FT                   /transl_table=11
FT                   /locus_tag="CD630_04570"
FT                   /old_locus_tag="CD0457"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67285"
FT                   /db_xref="GOA:Q188P9"
FT                   /db_xref="UniProtKB/TrEMBL:Q188P9"
FT                   /protein_id="CAJ67285.1"
FT                   /translation="MILIVILSIFIIASINIIILGKENIRDIVIPLTLFIVSDFLFLCG
FT                   NIICRGGVMLLFIGLFAIPLMLIAFIWICVHMIKLYYKKDLNKRKMIGCIFSIFISIGT
FT                   IFIPSPSESFRFKLYEKDYSVVAKAILKVYDEKKLSSESVFYIQSDKNELEKIFSKEVI
FT                   KKMKKLNRNLDVVKISGNRNLVYFFFGAELQSIDGIVIFKDLKHVKPKLDFINRSIQAP
FT                   RLEYITNNVYYFKGEL"
     atgatactaa tagttatatt gagtatattc atcatagcct caatcaacat aattatatta        60
     ggtaaagaaa atataagaga tatagttatc cctttaactc tatttattgt aagtgatttt       120
     ttatttttgt gtggaaatat aatatgtagg ggaggagtaa tgctactatt tataggttta       180
     tttgcaatac cattgatgct aattgcattt atatggattt gtgtacatat gattaagctt       240
     tactataaaa aagatttaaa taaaagaaaa atgattggat gtatatttag tatctttata       300
     agtataggta ctatatttat tcctagtcca agtgaaagtt ttagatttaa actttatgaa       360
     aaagattata gtgtagtagc taaagctatt ttgaaagttt atgatgaaaa aaagttaagc       420
     tctgaatctg tcttttatat tcaatctgat aaaaatgaat tggagaagat attttctaaa       480
     gaagtaataa aaaaaatgaa aaaactaaac agaaatttag atgtagttaa aatttctggg       540
     aatagaaatt tagtctattt tttctttgga gctgaattac aatctattga tggtattgtg       600
     atttttaaag atttaaaaca tgttaaacca aagttagatt ttataaatag aagtattcaa       660
     gctcctagac tggagtatat tacaaataat gtatattatt ttaaaggtga actataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page