(data stored in ACNUC9435 zone)

EMBL: AM180355.PE483

AM180355.PE483       Location/Qualifiers
FT   CDS_pept        546662..547345
FT                   /transl_table=11
FT                   /locus_tag="CD630_04590"
FT                   /old_locus_tag="CD0459"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67287"
FT                   /db_xref="GOA:Q188Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q188Q2"
FT                   /protein_id="CAJ67287.1"
FT                   /translation="MEILKCENLTKIYGSNQTRVTALNNVNLSVQKGDFVSIVGASGSG
FT                   KSTLLHLLGGVDRPTSGKIYVEDTEISSLKEEALAVFRRRKVGLIYQFYNLIPTLDVRK
FT                   NILLPMLLDKRKVDEDRFSEIVSILGLSDRLNHLPSQLSGGQQQRVSIARSLIYRPAIL
FT                   LADEPTGNLDRKNSEEIVDLLNLSNKRFNQTILLITHDEKIALEANRIVTMEDGVIVSE
FT                   KVVKK"
     atggaaatat taaaatgtga aaatctcaca aaaatatatg gttcaaatca aaccagagtg        60
     acagccctta ataatgtaaa tttatcagtt caaaaaggtg attttgtatc cattgtagga       120
     gcatctggtt ctggcaaatc tacattgtta catctgcttg ggggagtaga tagacctaca       180
     tctggaaaga tttatgttga agatacagaa atatcaagtt taaaggaaga agctcttgca       240
     gtttttagac gtagaaaagt aggtcttatt tatcaatttt ataatcttat acctaccctt       300
     gatgttagaa aaaatatatt attacccatg ttacttgata aaagaaaggt ggatgaggat       360
     agattctctg agattgtatc tatattggga ttatctgata gattaaacca tcttccaagt       420
     caactttcag gtggacaaca acaaagggta tctatagcta gaagtttaat ctatagacca       480
     gctattttat tagcagatga gccaactggt aatcttgata gaaaaaattc agaagaaatt       540
     gtagacttgt taaacttatc aaataaacga tttaatcaga caatacttct tattactcat       600
     gatgagaaaa tagcactaga ggcaaatcgt attgtaacta tggaagatgg agtgattgtc       660
     tctgaaaagg tggtgaagaa atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page