(data stored in ACNUC9435 zone)

EMBL: AM180355.PE499

AM180355.PE499       Location/Qualifiers
FT   CDS_pept        complement(565058..565684)
FT                   /transl_table=11
FT                   /locus_tag="CD630_04750"
FT                   /old_locus_tag="CD0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67303"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q188R4"
FT                   /protein_id="CAJ67303.1"
FT                   /translation="MKINIKSKLSEFIKQNNLFDDSRIISYLPNITIETDKIKTIMINE
FT                   VVPTNTNDDFYSVDKDADYLKTTIPLFDSAGIKVSNINDILDMGIYITNAVKLPKSEYT
FT                   ITRDTIKLHMPILEEEIKLFKNLEVVMLMGDVAKKSFNMITKKHIKKNVIPSISTYKLR
FT                   NNELYYDNLRVFPSYIMTGGNILIEKSKFEMASEDIKKMFEIING"
     atgaaaataa atataaaatc aaagttaagt gaatttatta aacagaacaa tctttttgat        60
     gacagcagaa taatatccta ccttcctaat ataacaatag aaacagacaa aataaaaact       120
     ataatgatta atgaggttgt cccaactaac accaatgacg atttttatag tgtagataaa       180
     gatgctgatt atttaaaaac tactattcct ttatttgaca gtgcaggaat aaaagtatct       240
     aacataaatg atatcctaga tatgggtatc tatataacta atgcagtaaa acttcctaaa       300
     tcagaatata caataactcg tgatacaatt aaattacata tgcctatttt agaagaagaa       360
     attaaattat ttaaaaacct agaggtagta atgttaatgg gagatgttgc aaaaaaatct       420
     tttaatatga ttactaaaaa gcatataaaa aagaatgtca tcccttccat ttcaacatat       480
     aaacttcgta ataatgaact ttattatgat aatttaagag tatttccatc atatattatg       540
     actggtggaa acatactgat tgaaaaatca aaatttgaaa tggcatcaga agatataaaa       600
     aaaatgttcg agattataaa cggttga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page