(data stored in ACNUC9435 zone)

EMBL: AM180355.PE512

AM180355.PE512       Location/Qualifiers
FT   CDS_pept        579018..579338
FT                   /transl_table=11
FT                   /locus_tag="CD630_04880"
FT                   /old_locus_tag="CD0488"
FT                   /product="putative small multidrug resistance SugE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67317"
FT                   /db_xref="GOA:Q188T1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q188T1"
FT                   /protein_id="CAJ67317.1"
FT                   /translation="MKWLFLFVAGLFEVFWAFQLKNSHGFSKLTPSILTVVGMIVSFYF
FT                   LSLALKHLPLGTSYAIWTGIGTVGTAIVGMAILNEPISISRIACIGFIVVGIVGLKLLS
FT                   TN"
     atgaaatggt tatttttgtt tgttgcaggt ttgtttgaag tgttttgggc ttttcaacta        60
     aaaaattcac atggattttc taaattaact ccaagtatac ttactgttgt tggaatgatt       120
     gtaagttttt attttttgtc attagcacta aaacatcttc cacttggaac ttcatatgca       180
     atatggactg gaattggtac cgtcggtaca gctattgtag gcatggctat tttaaatgag       240
     cctattagta tatcaagaat tgcatgtata ggttttattg tggtgggaat tgtagggtta       300
     aagctattat ctactaatta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page