(data stored in ACNUC9435 zone)

EMBL: AM180355.PE580

AM180355.PE580       Location/Qualifiers
FT   CDS_pept        655805..656461
FT                   /transl_table=11
FT                   /locus_tag="CD630_05500"
FT                   /old_locus_tag="CD0550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67383"
FT                   /db_xref="GOA:Q188Z6"
FT                   /db_xref="UniProtKB/TrEMBL:Q188Z6"
FT                   /protein_id="CAJ67383.1"
FT                   /translation="MKKGDFIWSGVLICIIAVLAIPSSREVFMEATGAHPYIGGFLKFA
FT                   VLATMGDLLGARILYKDWKIPVGVFYRAIVWGIIGVVTTYGMSIYSSGVGQAQVDGMLP
FT                   FEGIAFANALFKSATMNILMSPTVFLFHKVMDCFIDKKYEVGKGIKVKLKDVVNIVDWN
FT                   AYLGFSVLKTIPFFWIPCHTIVFLFPAEYRVIASAFASIALGLILALANKSKVAV"
     atgaaaaaag gcgattttat atggagtgga gttcttattt gtattattgc tgtcttagca        60
     ataccaagta gtagagaagt atttatggaa gcaacaggtg cacatccata tattggaggt       120
     tttttaaagt ttgctgtatt agctacaatg ggagatttac ttggtgctag aattttgtat       180
     aaggattgga aaataccagt aggagtattt tatagagcaa tagtttgggg aataataggt       240
     gtagttacca catatggaat gtcaatctac tcatcaggtg taggtcaagc acaagtggat       300
     ggtatgcttc catttgaggg aatagctttt gcaaatgctc tatttaagag tgcaactatg       360
     aatatactaa tgtcaccaac tgtattttta ttccataagg ttatggactg ttttatagat       420
     aaaaaatatg aggttggaaa ggggattaag gtaaaactta aagatgtggt aaatattgtg       480
     gactggaatg cttaccttgg ttttagtgtt ttaaaaacta taccattttt ctggatacca       540
     tgtcatacaa ttgtattttt attccctgct gagtatagag taattgcttc tgcatttgca       600
     tctatagctt taggtctaat attggcttta gctaataagt ctaaagttgc agtttag          657
//

If you have problems or comments...

PBIL Back to PBIL home page