(data stored in ACNUC9435 zone)

EMBL: AM180355.PE99

AM180355.PE99        Location/Qualifiers
FT   CDS_pept        114647..114916
FT                   /transl_table=11
FT                   /locus_tag="CD630_00930"
FT                   /old_locus_tag="CD0093"
FT                   /product="Ribosomal protein L14E/L6E/L27E-like"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66911"
FT                   /db_xref="GOA:Q18CI3"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CI3"
FT                   /protein_id="CAJ66911.2"
FT                   /translation="MLSDNLSIGQVVKVSLGRDKGNLFFVVKIINNEYVLIADGKKRKL
FT                   DKPKLKKVKHLKKYNFINDEVRKRVVSGQEITDSFLRAELTKLN"
     gtgctatcag ataatttaag tataggtcaa gttgttaaag tttcattagg acgagataaa        60
     ggaaatttat tctttgtagt caaaataatt aataatgaat atgtattaat agctgatgga       120
     aaaaagagaa aacttgacaa acctaagtta aagaaagtga agcacttaaa aaaatataat       180
     tttattaatg atgaagttag aaaaagagta gtatctggac aagagattac agattctttt       240
     ttaagagctg aacttactaa gttaaattag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page