(data stored in ACNUC9435 zone)

EMBL: AM180355.PURE

AM180355.PURE        Location/Qualifiers
FT   CDS_pept        281723..282199
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CD630_02180"
FT                   /old_locus_tag="CD0218"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67039"
FT                   /db_xref="GOA:Q18CV6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CV6"
FT                   /protein_id="CAJ67039.1"
FT                   /translation="MKVAVVMGSKSDYPKLEEGIKLLEKYGIEVVARALSAHRTPEQLS
FT                   IFLKEIEDDTDVIIAAAGKAAHLPGVIASQTLIPVIGLPIKSSTMDGLDSLLSIVQMPK
FT                   GIPVATVTIDLGLNAALLALQIMTLKYPKLKEDLKSYREEMAQKVLEDDKNLRG"
     atgaaagtag cagtagttat gggttcaaaa tcagattatc caaaattaga agaagggata        60
     aaactgcttg aaaaatatgg aatagaagtt gtagcaagag cattatcagc tcatagaaca       120
     ccagaacaac tttcaatatt cctaaaagaa atagaagatg atactgatgt aataatagca       180
     gcagcaggaa aagcagcaca cttaccaggt gtaatagctt cacaaacatt aattcctgta       240
     ataggattac ctattaaatc atcaactatg gatggactag actcactttt atcaatagtt       300
     caaatgccaa aaggaatccc agttgcaaca gttacaatag acttaggttt aaacgcagct       360
     ttattggcat tacaaataat gactttaaaa tacccaaaat taaaagagga tttgaaatca       420
     tatagagaag agatggcaca aaaggtgtta gaagacgaca agaatttaag ggggtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page