(data stored in ACNUC9435 zone)

EMBL: AM180355.RBSA

AM180355.RBSA        Location/Qualifiers
FT   CDS_pept        362100..363611
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="CD630_03010"
FT                   /old_locus_tag="CD0301"
FT                   /product="ABC-type transport system, ribose-specific
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67123"
FT                   /db_xref="GOA:Q18D42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D42"
FT                   /protein_id="CAJ67123.1"
FT                   /translation="MSNIILKLSNIAKEFPGVRALDNVNFELFHGEVHALLGENGAGKS
FT                   TMIKILTGAHSKTSGKFIFEGKEIEHISPDISKKIGINAIYQELTVFDELTVAQNIFMG
FT                   KEINGKVLTNDKKMNEEAKKIFDNMGIDINPNSLVKELSIAQKQMVEIARVLSSETKVL
FT                   IMDEPTSSISKKETEILFRLINDLKESGVSIIYISHRMEELFEICDRITIMRDGKTIST
FT                   LNTKDVSSEEELVNLMIDRKLDQFFPKRKVEIKEEIMRVENLTKNNVFNDISFNIRKGE
FT                   ILGIGGLVGSKRSEIVEAILGLRTYDSGKIYLNNEEVKFKTPSDAIENGLGLITEDRKG
FT                   TGLFLQMSVKENTTMAGLKKISKFKSIIDRKKEKEILEKYIEALKIKTPHMNQVIQSLS
FT                   GGNQQKAIIARWLLLQPDILIMDEPTRGIDVNAKAEIYNLMGDLVESGVSIIMISSEIP
FT                   ELISMSDRIMVMREGHISGFLEGEEMVENNVLKLAFGGKINEFNN"
     atgagtaata taattctgaa gttaagtaat attgctaaag aatttcctgg tgtcagagca        60
     ttagataatg ttaattttga gttatttcat ggcgaagttc atgcactact gggtgaaaat       120
     ggtgctggta aatcaacaat gataaagatt ttaactgggg cacattcgaa aacttctgga       180
     aaatttattt ttgaaggcaa agaaatagag catatatccc cagatatctc taaaaagata       240
     ggtataaatg ccatatatca agaactaaca gtttttgacg aattaacagt agcacaaaat       300
     atttttatgg gaaaagaaat aaatggcaaa gtcttaacca atgacaaaaa aatgaatgaa       360
     gaagctaaaa agattttcga taatatggga atagatataa atccaaatag tttagtcaaa       420
     gagcttagta tagctcaaaa acaaatggta gaaatagcaa gagttttatc atcagaaact       480
     aaagtattaa taatggatga acctacttct tcaataagta aaaaagagac tgaaatactt       540
     tttagactta taaatgattt aaaagagagt ggagttagta taatatatat atcccatagg       600
     atggaagaac tctttgagat ttgtgacaga ataactataa tgcgagatgg gaaaacgatt       660
     tcgactttga ataccaaaga tgtatcgtct gaggaagaat tagttaattt aatgatagat       720
     agaaagctag accaattttt cccaaaaaga aaagtagaaa taaaagaaga aattatgcga       780
     gtggaaaatc taactaagaa caatgttttt aatgatatta gctttaatat aagaaaaggt       840
     gaaatattgg gaataggtgg actagttgga agtaagagaa gtgaaatagt agaagctata       900
     cttggactta gaacatatga ttctggaaaa atatatttaa acaatgaaga agtaaagttt       960
     aaaactccat cagatgcaat agaaaatgga ctaggattaa taacagaaga tagaaaaggt      1020
     actggattgt ttttacaaat gagtgtcaaa gaaaatacaa ctatggctgg gttaaaaaag      1080
     atatctaagt ttaaatcaat tatagataga aaaaaggaaa aagagatttt agaaaaatac      1140
     atagaagctt taaagataaa aacaccacat atgaatcaag ttatacaaag tttaagtggt      1200
     ggaaaccaac aaaaagctat aatagcaaga tggcttttat tacaaccaga tatattgatt      1260
     atggatgaac caaccagagg tatagatgta aatgctaagg cagagatata caatctaatg      1320
     ggagatttag tggagagtgg tgtaagtata ataatgatat cttctgaaat accagaatta      1380
     atatcaatga gtgacagaat aatggttatg agagaaggtc atataagtgg atttttagaa      1440
     ggtgaagaaa tggttgaaaa taatgtatta aaattggctt tcggaggtaa aattaatgag      1500
     ttcaataact aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page