(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLK

AM180355.RPLK        Location/Qualifiers
FT   CDS_pept        86164..86589
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CD630_00610"
FT                   /old_locus_tag="CD0061"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66876"
FT                   /db_xref="GOA:Q18CE5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CE5"
FT                   /protein_id="CAJ66876.1"
FT                   /translation="MAKKVIGQIKLQIPAGKATPAPPVGPALGQHGVNIMGFTKEFNAK
FT                   TADQAGMIIPVVITVYQDRSFSFITKTPPAAVLIKKALNLKSGSGEPNKKKVAKMTSAQ
FT                   VREIAELKMPDLNAASVEAAMSMIAGTARSMGVVIED"
     atggctaaaa aagttatagg tcaaataaaa ttacaaatac ctgcaggaaa ggctactcca        60
     gcgccaccag ttggaccagc attaggacaa catggtgtta atataatggg attcacaaaa       120
     gaatttaatg ctaaaactgc agatcaagct ggaatgataa taccagttgt tataactgta       180
     tatcaagata gatcattcag ttttataaca aaaactccac cagctgcagt tttaattaaa       240
     aaagcattaa acttaaaatc aggttctgga gaaccaaaca agaaaaaagt tgctaaaatg       300
     acttcagctc aagtaagaga aatagctgaa ttaaagatgc ctgacttaaa tgctgcatca       360
     gtagaagctg ctatgagtat gatagctggt actgctagaa gcatgggtgt tgtaatcgaa       420
     gactaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page