(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLR

AM180355.RPLR        Location/Qualifiers
FT   CDS_pept        110325..110693
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CD630_00870"
FT                   /old_locus_tag="CD0087"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66904"
FT                   /db_xref="GOA:Q18CH4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CH4"
FT                   /protein_id="CAJ66904.1"
FT                   /translation="MLKKADKNANRLQRHKRVRRKISGTSQRPRLCVFRSANNIYAQII
FT                   DDTKRVTLVAASSLEAEVKSAVNHTGNKEAAKKVGELVAKKAVEKGITEVVFDRGGYLY
FT                   HGRIQELAEGAREAGLKF"
     gtgttaaaaa aggctgataa aaatgctaat agacttcaaa gacataagag agttcgtaga        60
     aaaataagcg gtacttctca aagaccaaga ttatgtgtat ttagaagtgc taacaatata       120
     tatgctcaaa taatagatga cacaaaaaga gtaactctag ttgctgcatc ttctttagaa       180
     gcagaagtta agagtgctgt caatcataca ggaaacaagg aagcagctaa gaaagttgga       240
     gaattagttg ctaaaaaagc tgttgaaaaa ggaatcactg aagttgtatt tgacagaggt       300
     ggatacttat atcatggaag aattcaagaa ttagctgaag gtgctagaga agctggtctt       360
     aagttctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page