(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSE

AM180355.RPSE        Location/Qualifiers
FT   CDS_pept        110714..111223
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CD630_00880"
FT                   /old_locus_tag="CD0088"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66905"
FT                   /db_xref="GOA:Q18CH3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CH3"
FT                   /protein_id="CAJ66905.1"
FT                   /translation="MLRRKPIDAGQLDLQEKVVEVRRVTKVVKGGRNFRFAALVVVGDE
FT                   NGHVGIGAGKAMEVPDAIKKAVEDAKKNLIVVPIVGTTIPHEVRGHFGAGNILIMPAVE
FT                   GTGVIAGGPARAVLELAGLKDVRAKSLGSNNPRNMVNATIEGLNSLKTVEDIAKLRGKK
FT                   VEELLG"
     atgctacgtc gtaagccgat agatgcagga caacttgact tacaagaaaa agttgttgaa        60
     gtaagacgtg ttactaaggt tgtaaaaggt ggtagaaatt tcagatttgc agcattagta       120
     gttgttggag atgaaaacgg acacgttggt ataggtgctg ggaaagcaat ggaagtacca       180
     gacgctataa aaaaagcagt tgaagatgct aagaaaaatc taatagtagt gccaatagtt       240
     gggactacaa ttcctcacga agtacgcgga cactttggtg ctggaaatat attaataatg       300
     cctgctgtag aaggtacagg agtaatagct gggggacctg ctagagccgt acttgagcta       360
     gctggactaa aagacgttag agctaaatct ttagggtcta acaatccaag aaatatggta       420
     aatgctacaa tagaaggact taattctcta aaaacagttg aagatatagc taaacttaga       480
     ggtaaaaaag ttgaagaact tctagggtaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page