(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSH

AM180355.RPSH        Location/Qualifiers
FT   CDS_pept        109318..109716
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CD630_00850"
FT                   /old_locus_tag="CD0085"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66902"
FT                   /db_xref="GOA:Q18CH0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CH0"
FT                   /protein_id="CAJ66902.1"
FT                   /translation="MTMTDPIADMLTRIRNANVVKHETVDVPASNMKKELARILLEEGF
FT                   IRGYDVIEDGKQGIIRIQLKYGQEGERVITGLKKISKPGMRVYAANHEIPKVLNGLGIS
FT                   VISTSKGILTDKQARKENVGGEVICYVW"
     atgacaatga cagatccaat tgcagatatg cttactcgta taagaaatgc taatgttgtt        60
     aagcatgaaa ctgtagatgt tccagcttct aatatgaaga aagaattagc tagaatctta       120
     ttagaagaag gtttcataag aggttatgat gttatagaag atggaaaaca aggtatcata       180
     agaatacaat taaagtacgg acaagaaggc gaaagagtta taacaggtct taagaaaata       240
     tctaagcctg gaatgagagt ttacgctgct aaccatgaga taccaaaagt attaaacgga       300
     ttaggaatat cagttatatc tacttcaaaa ggaatattaa ctgacaagca agctagaaaa       360
     gaaaatgttg gtggagaagt aatctgctac gtttggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page