(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSL

AM180355.RPSL        Location/Qualifiers
FT   CDS_pept        97692..98114
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CD630_00680"
FT                   /old_locus_tag="CD0068"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66883"
FT                   /db_xref="GOA:Q18CF2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CF2"
FT                   /protein_id="CAJ66883.2"
FT                   /translation="MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRG
FT                   VCTSVKTVTPRKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK"
     atgccaacaa ttaaccaatt agttcgtaaa agtagaaaag cgctagagaa gaaatctact        60
     gctccagcat tacaaaaagg ttacaactct ttaaataaga aagtaactga cgctagtgcc       120
     ccacaaaaaa gaggggtttg tacttcagta aaaacagtta ctcctaggaa gcctaactca       180
     gctttaagaa aagttgccag agttagatta actaatggta tagaagtttc tgcttatata       240
     ccaggagaag gacacaactt acaagagcat agtgttgttc ttataagagg aggaagagta       300
     aaagaccttc caggggttag ataccatata ctaagaggta ctctagatac agcaggtgtt       360
     gataagagaa gacaatcaag atctaaatac ggtgcgaaga gacctaaaga agctaaaaag       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page