(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSM

AM180355.RPSM        Location/Qualifiers
FT   CDS_pept        115474..115845
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CD630_00950"
FT                   /old_locus_tag="CD0095"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66914"
FT                   /db_xref="GOA:Q18CI0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CI0"
FT                   /protein_id="CAJ66914.1"
FT                   /translation="MARIAGVDLPREKRAEIGLTYIYGIGKATANEILAKAEINPDTRI
FT                   KDLSEDQVNELRKVIDDDFLVEGDLRREIALNIKRLRDIKCYRGIRHAKGLPLRGQRTK
FT                   TNARTRKGPRKTVSRKKKK"
     atggcaagaa tagctggggt agatttacct agagaaaaaa gagcggagat aggcttaact        60
     tatatatatg gtataggtaa agcaactgct aacgaaatat tagctaaggc tgagataaat       120
     ccagatacta gaataaaaga tttatcagaa gatcaagtta atgagttaag aaaagttata       180
     gatgacgatt tcttagttga aggtgactta agaagagaaa ttgctttaaa cataaagaga       240
     ttaagagata taaaatgtta tagaggaata agacacgcta aaggtcttcc attaagagga       300
     caaagaacta agactaatgc tagaactaga aaaggtccta gaaaaacagt atctcgtaaa       360
     aagaaaaaat aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page