(data stored in ACNUC9435 zone)

EMBL: AM180355.RSBW

AM180355.RSBW        Location/Qualifiers
FT   CDS_pept        9450..9857
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="CD630_00100"
FT                   /old_locus_tag="CD0010"
FT                   /product="Serine-protein kinase RsbW"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66824"
FT                   /db_xref="GOA:Q18C93"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q18C93"
FT                   /protein_id="CAJ66824.1"
FT                   /translation="MACETIKMEITTNPDYVSIIRLTASGIANKMGFPIDDIEDIKVAV
FT                   SEACTNAIKHSKDDVFNIVFNILDNAINIEIQDNGKGYDVSSISTPDLENPKESGLGLF
FT                   IIKTLMDDVDIESEHNQGTKIKMTKYLGVDI"
     ttggcttgtg agactataaa gatggaaatt actacaaatc cagattatgt tagtataata        60
     agattaacag catctggaat tgccaataag atgggttttc caatagatga tatagaagat       120
     ataaaggtag cagtatctga agcatgtaca aatgcaataa aacacagtaa agatgatgtg       180
     tttaatatag tatttaatat tttagataat gcaattaata tagaaattca agataatgga       240
     aaaggatatg atgttagctc aataagtaca ccagatttag agaatccaaa agagagtggt       300
     cttggattgt ttataattaa aactttaatg gatgatgtag atattgaatc agaacataat       360
     caagggacaa aaataaaaat gactaaatat ttaggagttg atatttaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page