(data stored in ACNUC9435 zone)

EMBL: AM180355.SECA1

AM180355.SECA1       Location/Qualifiers
FT   CDS_pept        189276..191951
FT                   /transl_table=11
FT                   /gene="secA1"
FT                   /locus_tag="CD630_01430"
FT                   /old_locus_tag="CD0143"
FT                   /product="Protein translocase subunit SecA1"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66963"
FT                   /db_xref="GOA:Q18CN0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CN0"
FT                   /protein_id="CAJ66963.1"
FT                   /translation="MSFMDNLFNMADKKELKKFNKTVDIIDSLEPKFESMADSELKNMT
FT                   NIFKERLANGESIDDILPEAFAVVREVSKRVLGLRHYRVQMIGGIVLHQGRIAEMKTGE
FT                   GKTLVATAPVYLNALTGKGVHVVTVNDYLAKRDRDQMAKIYEFLGMSVGVIIHGQNPKV
FT                   RKEQYDCDITYGTNNEYGFDYLKDNMVIHKEQRVQRGLNYAIVDEVDSILIDEARTPLI
FT                   ISGPGDKSTHLYSDANTFVLTLKPDDYELEEKDKAVSLTASGIQKAEVYFNVDNITDIS
FT                   HTELYHHINQALRAHVIMKKDVDYVAKDGEIVIVDEFTGRLMFGRRYSEGLHQAIEAKE
FT                   GLKIQRESKTLATVTFQNYFRMYKKLSGMTGTAKTEEEEFKAIYKMDVFQVPTNKLMIR
FT                   EDLPDCVYKSEIGKFNAVAQEIIERHKVNQPILVGTVSIEKSELLSQILKKKGIKHEVL
FT                   NAKHHDKEAEIIAQAGRLGAVTIATNMAGRGTDIVLGGNPDFLTKREMRRNGFKEEIVN
FT                   RVDTPIEGIPVKGNEILFEAREEYEKLFEKFKQQTQEEQKQVVEAGGLAIIGTERHESR
FT                   RIDNQLRGRAGRQGDPGSSRFYIGLDDDLMRLFGSDRISGIVDKIGLEEDMPIEHRILS
FT                   KSIEGAQKKVEGKNFGIRKHVLQYDDVMNKQREIIYAERKRVLEGEDLQEQIQSMTHSI
FT                   IEEAVTLYTQDKGFDEEGFKEHMYNLFLPKGSIEIPEIEKLNPVEITEKVYEIAMKIYT
FT                   SKEEQVGYERMREVERVILLQAVDNHWIDHIDAMDQLRQGIGLRAVGQQDPVIAYKMEG
FT                   FDMFDEMNKHIKEDTVRYLFNITIETPVERKAVVDVENLSSPSDGTLPTSKTVKKDEKV
FT                   GRNDLCPCGSGKKYKNCCGR"
     atgagcttta tggataattt attcaacatg gcagataaaa aagaattaaa aaagttcaat        60
     aaaactgttg atataataga ttcattagaa cctaaatttg aatctatggc agactcggaa       120
     cttaaaaata tgacaaatat atttaaagaa agattagcaa atggtgaaag tatagatgat       180
     atacttccag aagcttttgc agtagttaga gaagtttcta agagagtgtt aggacttaga       240
     cactacagag ttcaaatgat tggaggtata gtactacatc aaggaagaat agcagaaatg       300
     aaaacaggtg aaggtaaaac tttggttgca actgctcctg tttatttgaa tgcgcttact       360
     ggaaaaggtg tacatgttgt aacagtaaat gattaccttg caaaacgtga tagagaccaa       420
     atggcaaaaa tctatgagtt tttaggaatg agtgtaggcg ttattataca cggtcaaaat       480
     ccaaaagtta gaaaagaaca atatgattgt gatataactt atggtacaaa taatgaatat       540
     ggatttgact atctaaagga caatatggta atacacaaag agcaaagagt tcaaagagga       600
     ttaaattatg ctatagtgga tgaggttgac tctatactaa tagatgaggc tagaacacca       660
     cttatcatat ctggacctgg agacaaatca actcacttat attcagatgc aaacacattt       720
     gttttaacct taaaaccaga tgattatgaa ttagaagaaa aagataaggc tgtatctcta       780
     acagcatcgg gtatacaaaa agcagaagtg tattttaatg ttgataatat aacagatata       840
     tctcatacag aattatacca tcatataaat caagctttaa gagcacatgt aataatgaag       900
     aaagatgttg attatgttgc taaagatgga gaaatagtaa tagtagatga gttcacaggt       960
     agacttatgt ttggtagaag atattcagaa ggtttacatc aagcaataga ggctaaagaa      1020
     ggtcttaaaa tacaaagaga atctaaaaca ctagctactg taacattcca aaactacttt      1080
     agaatgtaca aaaaactttc tggtatgact ggtacagcaa aaacagaaga agaagagttt      1140
     aaagcaatct acaaaatgga tgttttccaa gtacctacta ataagcttat gataagggaa      1200
     gacttaccag actgtgtata caaaagtgaa ataggtaaat ttaatgctgt agcacaagaa      1260
     ataattgaaa ggcacaaagt caatcaacca atacttgtag gtacagtatc aatagaaaaa      1320
     tcagaattat tatcacaaat actaaagaaa aagggcataa agcacgaggt attaaatgct      1380
     aagcatcatg ataaagaggc agaaataata gcacaagctg gtagacttgg agctgttaca      1440
     atagctacta atatggctgg tcgtggtaca gatatagttc taggtggaaa tccagatttt      1500
     ttaactaaga gagaaatgag aagaaatgga tttaaagaag aaatagtaaa tagagtagat      1560
     actccaatag aaggtatacc tgtaaaaggt aatgaaattc tatttgaagc tagagaagag      1620
     tatgaaaaac tatttgaaaa gtttaagcaa caaacgcaag aagaacaaaa acaagttgta      1680
     gaagcaggtg gacttgctat aatcggtaca gaaagacacg aatctcgaag aatagataac      1740
     cagttgagag gtcgtgctgg acgtcaaggt gacccaggga gttcaagatt ctatataggt      1800
     cttgatgatg accttatgag attgtttggt agtgatagaa tatctggtat tgtagataaa      1860
     ataggtcttg aagaagacat gccgatagaa catagaatat tatctaagtc tattgaagga      1920
     gcacaaaaga aagtcgaagg taaaaacttt ggaataagaa agcatgtact tcaatatgat      1980
     gatgttatga ataaacaaag agaaataata tatgcagaga gaaaacgtgt attagaaggt      2040
     gaagatttac aagaacaaat acaatcaatg actcattcta taatagaaga agcagttact      2100
     ctttatacac aagataaagg atttgatgaa gaaggattca aagaacatat gtataatctg      2160
     ttcttgccaa aaggtagcat agaaatacca gaaatagaaa aacttaatcc agttgaaata      2220
     acagaaaaag tttatgaaat agctatgaag atatatactt caaaagaaga acaagttggc      2280
     tatgagagaa tgagagaagt tgagagagta atcttacttc aagctgttga taaccattgg      2340
     atagaccata tagatgctat ggaccaatta cgccaaggta ttggtcttcg tgctgtaggt      2400
     cagcaagacc cagttattgc ttataaaatg gaaggttttg atatgtttga tgaaatgaat      2460
     aaacatatca aagaagatac tgtaagatat ttatttaata taacaataga aactccagtg      2520
     gaaagaaaag cagttgtaga tgttgaaaat ctatcttctc catcagatgg aacacttcca      2580
     acaagtaaaa ctgttaaaaa agatgaaaag gttggaagaa atgacttatg cccttgtgga      2640
     agtggtaaaa aatataaaaa ctgttgtgga agataa                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page