(data stored in ACNUC9435 zone)

EMBL: AM180355.SLEC

AM180355.SLEC        Location/Qualifiers
FT   CDS_pept        complement(656969..658240)
FT                   /transl_table=11
FT                   /gene="sleC"
FT                   /locus_tag="CD630_05510"
FT                   /old_locus_tag="CD0551"
FT                   /product="Spore cortex-lytic enzyme pre-pro-form"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67384"
FT                   /db_xref="GOA:Q188Z5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q188Z5"
FT                   /protein_id="CAJ67384.1"
FT                   /translation="MQDGFLTVSIIDATNNRPIQNAVVNIYSMSNGSQSSSTLYQNLRS
FT                   NESGQVTGLVLPAPDVDYSLQPSDVRPYSQYIVEAIADGYETVVIEGTQLLATIEARQG
FT                   VPMSPRTRSKRSFSRQSELIFDIGEHTLYGTYPPKIPESNLKPLPPPTGFVVLDNPVVP
FT                   EFIVVHDGLPEDSSAPNYWIPFKEYIKNIASSEIYSTWPEQTIYANVIAIISFTLNRVF
FT                   TEWYRNKGYNFTITSTTAYDHKFINNRNLFEPINVVVDAIFNTFIKRPPTSRQPLLAQY
FT                   CDGQKSQCPDQMTQWGSKDLGDQGYDYESILRYFYGDEIVFERAPIVSGVPVSFPGTTL
FT                   QVGSSGQYVRTIQNQLNAISNSYPAVPKVIEDGIYGTDTENAVKIFQGIFGLPQSGVVD
FT                   FKTWYEISRVYVATTRIASLNPLI"
     atgcaagatg gtttcttaac agtaagcata attgatgcta ctaacaatag acctattcaa        60
     aatgcagtag taaacatata ttcaatgtct aatggtagcc aaagctcatc aactttatac       120
     caaaacctaa gaagtaatga atctggtcaa gtgactggtt tagtattacc agcaccagat       180
     gtagattact ctctacaacc atctgatgtt agaccttata gccagtatat agtggaagcc       240
     atagcagatg gatatgagac agttgtcata gaaggaacac agttgttagc tacaattgaa       300
     gcaagacaag gagttcccat gtctcctaga acaagaagta agcgttcttt ctcaagacaa       360
     agtgagttga tttttgatat aggagaacat actctatatg gtacttatcc tcctaagatt       420
     ccagaaagta acttaaaacc attacctcct cctactggtt tcgttgtatt agataaccct       480
     gtagtgcctg aatttatagt agttcatgat ggtttgccag aagattcatc agctccaaac       540
     tattggattc catttaaaga gtacattaaa aacatagcgt catctgaaat atattcaact       600
     tggcctgaac agacaattta tgcaaatgta atagctataa tatcatttac tttaaataga       660
     gtctttactg aatggtatag aaataaagga tataacttta caataacttc aacaacagca       720
     tacgaccata agtttataaa taatagaaac ttatttgaac caattaacgt agttgtagat       780
     gctattttta atacttttat aaaaagacct cctacatcaa gacagccact attagcacaa       840
     tattgtgatg gacaaaaatc ccaatgtcct gaccaaatga ctcaatgggg cagtaaagac       900
     ttaggtgacc aaggatatga ctatgagagt atactaagat atttctatgg agatgaaata       960
     gtatttgaaa gagcacctat agtaagtggt gtaccagtgt cattccctgg tactacacta      1020
     caagttggtt cttctgggca gtatgttaga accatacaaa atcagttaaa tgctatatct      1080
     aattcttatc cagctgtacc aaaagttata gaagatggta tctatggaac agatacagaa      1140
     aacgctgtta agatattcca aggaatcttt ggtttacctc aaagcggagt agtagatttt      1200
     aaaacatggt atgaaatatc cagagtttat gtagctacaa ctagaatagc ttctttaaat      1260
     cctttaattt aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page