(data stored in ACNUC9435 zone)

EMBL: AM180355.SPOIID

AM180355.SPOIID      Location/Qualifiers
FT   CDS_pept        169522..170586
FT                   /transl_table=11
FT                   /gene="spoIID"
FT                   /locus_tag="CD630_01240"
FT                   /old_locus_tag="CD0124"
FT                   /product="Stage II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66944"
FT                   /db_xref="GOA:Q18CL6"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="PDB:5I1T"
FT                   /db_xref="PDB:5TXU"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CL6"
FT                   /protein_id="CAJ66944.1"
FT                   /translation="MKNPLVVLLGFVTCSVLVPSLITLVSYKNVELTEKPESPVSINKT
FT                   IKKSDIEDKGNKEEKNTVNYETVNKKAPIINVYNHITGKTEKMDMENYLCGVLAGEMSS
FT                   EFDIEALKAQSVAARTYVVYKQEHGKSSKHKNAVVCTDYKHCQEYKSYDTLKKLNGEEW
FT                   IKNKYSKIQEAVRGTKGQIITYNDKAILPLYFSTSSGKTENSEEVFSAKYPYLKSVESP
FT                   YDKYSPKFASTLKISNTDFVKSLRRAYSTIVIDVNNLSKQVSITKRSDAGTVEKIKLGN
FT                   KELTGKDIRTVFKLNSANFDIKFGEGYIDFVVKGYGHGVGMSQWGAEGMAEEGYKYYDI
FT                   LSHYYTDTKIKDIY"
     atgaagaacc cattggttgt tttgttagga tttgtgactt gctctgtgtt agttccatca        60
     cttataactt tagtttctta taaaaatgta gaattaactg aaaaaccaga gagcccagta       120
     tctataaaca aaactattaa aaaaagtgat attgaagaca aaggtaataa agaagaaaaa       180
     aatacagtga actatgaaac tgtaaataaa aaagcaccaa ttatcaatgt atataatcat       240
     ataacaggga aaaccgaaaa gatggacatg gagaactatt tatgtggagt actagctggt       300
     gagatgtctt cagagtttga tatagaagct ttaaaagctc aatctgtagc agctagaaca       360
     tatgtagtat ataaacaaga acatggtaaa tctagtaaac ataaaaatgc agtagtatgt       420
     actgattata aacattgtca agaatataag agttatgata ctcttaaaaa attaaatggt       480
     gaagaatgga ttaagaataa atattccaaa atccaagaag cagttagagg aactaaaggt       540
     caaataataa cttataatga taaggcgata cttcctcttt atttttctac atcttcagga       600
     aaaacagaaa atagtgaaga agtattttct gcaaaatatc cttatttaaa gtctgtggaa       660
     agtccttatg ataagtattc ccctaaattt gcgtcaacac ttaaaataag taacacagat       720
     tttgttaaaa gtcttagaag ggcatatagc actattgtga tagatgtgaa taatttaagt       780
     aaacaagttt caataactaa aagaagtgat gccggaactg tagaaaaaat aaaattagga       840
     aataaagaat tgactggaaa agacattaga actgttttta aattgaactc tgcaaacttt       900
     gacataaaat ttggagaagg atacatagat ttcgtggtaa aaggatatgg tcatggtgtt       960
     ggtatgagcc agtggggagc agaaggaatg gcagaagagg gctataaata ttatgatata      1020
     ttatcacatt actacacaga tacaaaaata aaagatatat actaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page