(data stored in SCRATCH zone)

EMBL: AM269952.PE1

AM269952.PE1         Location/Qualifiers
FT   CDS_pept        <3..617
FT                   /locus_tag="An01g00740"
FT                   /product="hypothetical protein [truncated ORF]"
FT                   /note="Remark: N-terminally truncated due to contig
FT                   border."
FT                   /db_xref="GOA:A2Q7H6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H6"
FT                   /protein_id="CAK43452.1"
FT                   /translation="NTIALLSQTLTVILDIVEVGSSIGLYTVTGVFATVLPVLGAVLAV
FT                   LGVVMMLINLFVNLFGGSPPPDPVQEFIDHVAKGLVGGFENAPPPKLDYTIPSVIYESG
FT                   EVTGITIKGENTTNDEISIPNARIVVNSGSDDVCLFSTDDFELVEDTDTDKDSDKHLYV
FT                   TPNSTAEGTLSSSVLGDETEYHEFDLVVGGKKRIRRTVCTN"
     aacacgatcg ctctgctttc gcaaacactc acggtgattt tggacatcgt cgaagtgggc        60
     tcatccattg gactgtatac agtcacaggg gtattcgcca cagtactgcc cgtcctcggg       120
     gctgtgctcg ccgttcttgg cgttgtaatg atgctcatca acctgttcgt gaacttgttt       180
     ggtggctctc cacctcccga cccggtgcag gagttcatcg accatgtagc caaaggccta       240
     gtcgggggat ttgaaaacgc gccgccgccg aaactcgact ataccatccc cagcgtcatc       300
     tacgaatccg gcgaagtgac cggcatcacc atcaaaggcg aaaacacaac gaacgatgag       360
     atcagcatcc ctaatgcccg gattgtggtg aacagcggca gcgacgacgt ctgtctgttc       420
     tctacggatg atttcgaact ggtggaggat acagacaccg acaaggattc ggataaacat       480
     ctctatgtaa ccccgaacag cacagccgag gggacattgt ccagtagtgt tctgggcgac       540
     gagacagagt accacgagtt tgatctagtg gtcggtggga aaaagaggat acggagaaca       600
     gtttgcacaa actga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page