(data stored in SCRATCH zone)

EMBL: AM269952.PE10

AM269952.PE10        Location/Qualifiers
FT   CDS_pept        complement(join(16857..16925,16976..17077))
FT                   /locus_tag="An01g00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7I5"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I5"
FT                   /protein_id="CAK43461.1"
FT                   /translation="MTVVNSKATVMEWKAKLTAKIELDSQSLESGMDHGQWLQYAKQSG
FT                   SDDGQFLTFLL"
     atgactgtgg ttaatagtaa ggcaacagtc atggagtgga aggcgaagtt gacggcaaag        60
     attgagttgg acagtcagtc gctagagagt ggaatggacc acggtcaatg gctacagtac       120
     gcgaagcaat caggaagtga tgatggacag tttttgactt ttctactcta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page