(data stored in SCRATCH zone)

EMBL: AM269952.PE11

AM269952.PE11        Location/Qualifiers
FT   CDS_pept        complement(join(17952..18032,18195..18421,18512..18601,
FT                   18680..18814,18907..19000))
FT                   /locus_tag="An01g00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7I6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I6"
FT                   /protein_id="CAK43462.1"
FT                   /translation="MPRELHRGRITQGNGRTVKSSLAKRQQHEGGRPTAKKPFRAIVGI
FT                   RCWLTRSVHPLARVSAMVLTPNFPAKEPVEDDPGYYPGNSIREPLASLVVASFDQRDAF
FT                   GSGSYCNPKCPVALPYGGLVGDLGKSGNNQRHGEQKRNRPDPRGGVTPHVPELSVVVNV
FT                   SHCGFGVMNTIPAPDLAIEKELTVQMTLDRGHILVRRCLGPQTPL"
     atgccaagag agttacacag aggcagaatc acgcagggaa acgggagaac agtcaagtca        60
     agcctcgcca agcgacagca acacgaggga ggccgcccaa cagccaagaa gccattccgg       120
     gcaattgtcg ggataagatg ctggcttact cgtagcgttc atccactggc gagggtcagc       180
     gcgatggtcc tgactcccaa tttcccagcg aaagaaccag tcgaggacga cccggggtat       240
     taccccggaa atagtatacg ggagccgtta gcttcgctgg tagtggcctc ctttgaccaa       300
     agagacgcat tcggaagtgg gtcctactgc aaccccaaat gtcccgttgc gttaccctac       360
     gggggattgg ttggggatct ggggaaatct gggaacaatc aacggcatgg cgaacaaaag       420
     aggaaccggc cagatccacg tggcggcgtc acccctcacg tgcctgagct tagcgtggtt       480
     gtcaacgtgt cgcactgtgg cttcggggtt atgaacacga ttcctgctcc agatctcgca       540
     attgagaagg agttgactgt gcaaatgacc cttgaccggg gtcatatcct agttcgacgt       600
     tgtttaggcc cccagacgcc actgtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page